• Gene id: 3621

Gene Summary

• Gene Symbol: ING1   Gene   UCSC   Ensembl
• Aliases: p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
• Gene name: inhibitor of growth family member 1
• Alternate names: inhibitor of growth protein 1, growth inhibitor ING1, growth inhibitory protein ING1, tumor suppressor ING1,
• Gene location: 13q34 (110712622: 110723338)     Exons: 5     NC_000013.11
• Gene summary(Entrez): This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduc
• OMIM: 601566

Protein Summary

• Protein general information: Q9UK53  
  • Name: Inhibitor of growth protein 1
  • Length: 422  
  • Mass: 46738
  • Tissue specificity: Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expre
• Sequence:

  MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSLGLQPWIGSSRCWGGP
  CSSALRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAWRVSPLPLSPLSPATFGRGFIAVAVIPGLWA
  RGRGCSSDRLPRPAGPARRQFQAASLLTRGWGRAWPWKQILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQ
  ELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNE
  NRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECP
  IEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR

• Structural information:
  • Interpro: IPR028643  IPR028651  IPR024610  IPR019786  IPR011011   IPR001965  IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • PDB: 2QIC
  • PDBsum: 2QIC
  • DIP: 24256 24257 24258
  • STRING: ENSP00000364929
• Other Databases: GeneCards:  ING1  Malacards:  ING1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0035064	methylated histone binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0010941	regulation of cell death	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0030308	negative regulation of cell growth	NAS	biological process

Diseases

Associated diseases	References
Squamous cell carcinoma	PMID:10866301
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881