• Gene id: 3619

Gene Summary

• Gene Symbol: INCENP   Gene   UCSC   Ensembl
• Gene name: inner centromere protein
• Alternate names: inner centromere protein, binds and activates aurora-B and -C in vivo and in vitro, chromosomal passenger protein, inner centromere protein INCENP, inner centromere protein antigens 135/155kDa,
• Gene location: 11q12.3 (62123997: 62155473)     Exons: 19     NC_000011.10
• Gene summary(Entrez): In mammalian cells, 2 broad groups of centromere-interacting proteins have been described: constitutively binding centromere proteins and 'passenger,' or transiently interacting, proteins (reviewed by Choo, 1997). The constitutive proteins include CENPA (
• OMIM: 601582

Protein Summary

• Protein general information: Q9NQS7  
  • Name: Inner centromere protein
  • Length: 918  
  • Mass: 105429
• Sequence:

  MGTTAPGPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTPSQKNRRKKRRISYVQ
  DENRDPIRRRLSRRKSRSSQLSSRRLRSKDSVEKLATVVGENGSVLRRVTRAAAAAAAATMALAAPSSPTPESPT
  MLTKKPEDNHTQCQLVPVVEIGISERQNAEQHVTQLMSTEPLPRTLSPTPASATAPTSQGIPTSDEESTPKKSKA
  RILESITVSSLMATPQDPKGQGVGTGRSASKLRIAQVSPGPRDSPAFPDSPWRERVLAPILPDNFSTPTGSRTDS
  QSVRHSPIAPSSPSPQVLAQKYSLVAKQESVVRRASRRLAKKTAEEPAASGRIICHSYLERLLNVEVPQKVGSEQ
  KEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAASSPETPSAGQQEAKTDQADGPREPPQSARRK
  RSYKQAVSELDEEQHLEDEELQPPRSKTPSSPCPASKVVRPLRTFLHTVQRNQMLMTPTSAPRSVMKSFIKRNTP
  LRMDPKCSFVEKERQRLENLRRKEEAEQLRRQKVEEDKRRRLEEVKLKREERLRKVLQARERVEQMKEEKKKQIE
  QKFAQIDEKTEKAKEERLAEEKAKKKAAAKKMEEVEARRKQEEEARRLRWLQQEEEERRHQELLQKKKEEEQERL
  RKAAEAKRLAEQREQERREQERREQERREQERREQERREQERQLAEQERRREQERLQAERELQEREKALRLQKEQ
  LQRELEEKKKKEEQQRLAERQLQEEQEKKAKEAAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMD
  LNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSP
  PLQGARVPSSLAYSLKKH

• Structural information:
  • Interpro: IPR039130  IPR022006  IPR005635  
  • PDB: 2QFA 4AF3 5IEH 5IEK 6GR8 6GR9
  • PDBsum: 2QFA 4AF3 5IEH 5IEK 6GR8 6GR9
  • DIP: 31304
  • STRING: ENSP00000378295
• Other Databases: GeneCards:  INCENP  Malacards:  INCENP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990385	meiotic spindle midzone	IBA	cellular component
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0032133	chromosome passenger complex	IBA	cellular component
GO:0016572	histone phosphorylation	IBA	biological process
GO:0010032	meiotic chromosome condensation	IBA	biological process
GO:0000776	kinetochore	IBA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IBA	biological process
GO:0051310	metaphase plate congression	IBA	biological process
GO:0051257	meiotic spindle midzone assembly	IBA	biological process
GO:0030496	midbody	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000793	condensed chromosome	IBA	cellular component
GO:0000281	mitotic cytokinesis	IBA	biological process
GO:0000776	kinetochore	IDA	cellular component
GO:1902412	regulation of mitotic cytokinesis	IEA	biological process
GO:0000070	mitotic sister chromatid segregation	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0007059	chromosome segregation	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030496	midbody	IEA	cellular component
GO:0000801	central element	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0010369	chromocenter	IEA	cellular component
GO:0000800	lateral element	IEA	cellular component
GO:0000795	synaptonemal complex	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005721	pericentric heterochromatin	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray