• Gene id: 3615

Gene Summary

• Gene Symbol: IMPDH2   Gene   UCSC   Ensembl
• Aliases: IMPD2, IMPDH-II
• Gene name: inosine monophosphate dehydrogenase 2
• Alternate names: inosine-5'-monophosphate dehydrogenase 2, IMP (inosine 5'-monophosphate) dehydrogenase 2, IMP (inosine monophosphate) dehydrogenase 2, IMP oxireductase 2, IMPD 2, IMPDH 2, epididymis secretory sperm binding protein, inosine 5' phosphate dehydrogenase 2, inosine m,
• Gene location: 3p21.31 (49029749: 49024324)     Exons: 15     NC_000003.12
• Gene summary(Entrez): This gene encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependen
• OMIM: 606670

Protein Summary

• Protein general information: P12268  
  • Name: Inosine 5' monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (IMPDH II)
  • Length: 514  
  • Mass: 55805
  • Tissue specificity: IMP type I is the main species in normal leukocytes and type II predominates over type I in the tumor.
• Sequence:

  MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTE
  AGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRM
  GSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIART
  DLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
  GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAK
  ALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDK
  GSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

• Structural information:
  • Protein Domains: (114..17-)
    (/note="CBS-1)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03156-)
    (179..23-)
    (/note="CBS-2)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03156"-)
  • Interpro: IPR013785  IPR000644  IPR005990  IPR015875  IPR001093  
  • Prosite: PS51371 PS00487
  • CDD: cd00381
  • PDB: 1B3O 1NF7 1NFB 6I0M 6I0O
  • PDBsum: 1B3O 1NF7 1NFB 6I0M 6I0O
  • STRING: ENSP00000321584
• Other Databases: GeneCards:  IMPDH2  Malacards:  IMPDH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003938	IMP dehydrogenase activity	IBA	molecular function
GO:0006183	GTP biosynthetic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000166	nucleotide binding	IDA	molecular function
GO:0007623	circadian rhythm	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003938	IMP dehydrogenase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0006164	purine nucleotide biosynthetic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006177	GMP biosynthetic process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006164	purine nucleotide biosynthetic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003938	IMP dehydrogenase activity	TAS	molecular function
GO:0003938	IMP dehydrogenase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0009168	purine ribonucleoside monophosphate biosynthetic process	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003938	IMP dehydrogenase activity	IEA	molecular function
GO:0003938	IMP dehydrogenase activity	IEA	molecular function
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0006164	purine nucleotide biosynthetic process	IEA	biological process
GO:0046651	lymphocyte proliferation	IEA	biological process
GO:0071353	cellular response to interleukin-4	IEA	biological process
GO:0006164	purine nucleotide biosynthetic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003938	IMP dehydrogenase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006177	GMP biosynthetic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005778	peroxisomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00983	Drug metabolism - other enzymes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881