• Gene id: 3613

Gene Summary

• Gene Symbol: IMPA2   Gene   UCSC   Ensembl
• Gene name: inositol monophosphatase 2
• Alternate names: inositol monophosphatase 2, IMP 2, IMPase 2, inosine monophosphatase 2, inositol monophosphatase 2 variant 1, inositol monophosphatase 2 variant 2, inositol(myo)-1(or 4)-monophosphatase 2, myo-inositol monophosphatase 2, myo-inositol monophosphatase A2,
• Gene location: 18p11.21 (11981464: 12030877)     Exons: 9     NC_000018.10
• Gene summary(Entrez): This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disord
• OMIM: 605922

Protein Summary

• Protein general information: O14732  
  • Name: Inositol monophosphatase 2 (IMP 2) (IMPase 2) (EC 3.1.3.25) (Inositol 1(or 4) monophosphatase 2) (Myo inositol monophosphatase A2)
  • Length: 288  
  • Mass: 31321
• Sequence:

  MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPS
  HRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGA
  FCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQF
  GLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

• Structural information:
  • Interpro: IPR033942  IPR020583  IPR020552  IPR000760  IPR020550  
  • Prosite: PS00629 PS00630
  • CDD: cd01639
  • PDB: 2CZH 2CZI 2CZK 2DDK 2FVZ
  • PDBsum: 2CZH 2CZI 2CZK 2DDK 2FVZ
  • STRING: ENSP00000269159
• Other Databases: GeneCards:  IMPA2  Malacards:  IMPA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046855	inositol phosphate dephosphorylation	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0008934	inositol monophosphate 1-phosphatase activity	IBA	molecular function
GO:0006020	inositol metabolic process	IBA	biological process
GO:0046855	inositol phosphate dephosphorylation	IEA	biological process
GO:0008934	inositol monophosphate 1-phosphatase activity	IEA	molecular function
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006796	phosphate-containing compound metabolic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008934	inositol monophosphate 1-phosphatase activity	TAS	molecular function
GO:0052833	inositol monophosphate 4-phosphatase activity	IEA	molecular function
GO:0008934	inositol monophosphate 1-phosphatase activity	IEA	molecular function
GO:0052834	inositol monophosphate phosphatase activity	IEA	molecular function
GO:0052832	inositol monophosphate 3-phosphatase activity	IEA	molecular function
GO:0046855	inositol phosphate dephosphorylation	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0008934	inositol monophosphate 1-phosphatase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006021	inositol biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Bipolar disorder	PMID:11673796
Bipolar disorder	PMID:9322233
Schizophrenia	PMID:11317223
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881