• Gene id: 3611

Gene Summary

• Gene Symbol: ILK   Gene   UCSC   Ensembl
• Aliases: HEL-S-28, ILK-1, ILK-2, P59, p59ILK
• Gene name: integrin linked kinase
• Alternate names: integrin-linked protein kinase, 59 kDa serine/threonine-protein kinase, epididymis secretory protein Li 28, integrin-linked kinase-2,
• Gene location: 11p15.4 (6603707: 6610873)     Exons: 15     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of t
• OMIM: 611211

Protein Summary

• Protein general information: Q13418  
  • Name: Integrin linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine protein kinase) (ILK 1) (ILK 2) (p59ILK)
  • Length: 452  
  • Mass: 51419
  • Tissue specificity: Highly expressed in heart followed by skeletal muscle, pancreas and kidney. Weakly expressed in placenta, lung and liver.
• Sequence:

  MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAA
  SHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRE
  RAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVR
  DWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
  MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADM
  WSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQ
  DK

• Structural information:
  • Protein Domains: (193..44-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR011009  IPR035692   IPR000719  IPR001245  
  • Prosite: PS50297 PS50088 PS50011
  • CDD: cd14057
  • PDB: 2KBX 3F6Q 3IXE 3KMU 3KMW 3REP 4HI8 4HI9 6MIB
  • PDBsum: 2KBX 3F6Q 3IXE 3KMU 3KMW 3REP 4HI8 4HI9 6MIB
  • DIP: 38657
  • STRING: ENSP00000379975
• Other Databases: GeneCards:  ILK  Malacards:  ILK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004672	protein kinase activity	IBA	molecular function
GO:0001725	stress fiber	IBA	colocalizes with
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007160	cell-matrix adhesion	TAS	biological process
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034329	cell junction assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005911	cell-cell junction	IEA	cellular component
GO:0007050	cell cycle arrest	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0007569	cell aging	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0010667	negative regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0014912	negative regulation of smooth muscle cell migration	IEA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0032288	myelin assembly	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043195	terminal bouton	IEA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0050772	positive regulation of axonogenesis	IEA	biological process
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0097435	supramolecular fiber organization	IEA	biological process
GO:0001558	regulation of cell growth	IEA	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0010761	fibroblast migration	IEA	biological process
GO:0014044	Schwann cell development	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0030030	cell projection organization	IEA	biological process
GO:0030513	positive regulation of BMP signaling pathway	IEA	biological process
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:2000178	negative regulation of neural precursor cell proliferation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0032956	regulation of actin cytoskeleton organization	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043034	costamere	IEA	cellular component
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0045663	positive regulation of myoblast differentiation	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0001725	stress fiber	IEA	cellular component
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0021675	nerve development	IEA	biological process
GO:0022011	myelination in peripheral nervous system	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030017	sarcomere	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0042327	positive regulation of phosphorylation	IMP	biological process
GO:0070527	platelet aggregation	HMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0009967	positive regulation of signal transduction	IMP	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04510	Focal adhesion
hsa04360	Axon guidance
hsa05100	Bacterial invasion of epithelial cells
hsa03320	PPAR signaling pathway
hsa05213	Endometrial cancer

Diseases

Associated diseases	References
Prostate cancer	PMID:15704679
Prostate cancer	PMID:18336616
pancreatic cancer	PMID:18772397
Ovarian cancer	PMID:14517840
prostate adenocarcinoma	PMID:11448915
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881