• Gene id: 3606

Gene Summary

• Gene Symbol: IL18   Gene   UCSC   Ensembl
• Aliases: IGIF, IL-18, IL-1g, IL1F4
• Gene name: interleukin 18
• Alternate names: interleukin-18, IFN-gamma-inducing factor, IL-1 gamma, iboctadekin, interleukin 18 (interferon-gamma-inducing factor), interleukin-1 gamma,
• Gene location: 11q23.1 (112164116: 112143250)     Exons: 6     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a proinflammatory cytokine that augments natural killer cell activity in spleen cells, and stimulates interferon gamma production in T-helper type I cells. Alternatively spliced transcript variants encoding different is
• OMIM: 600953

Protein Summary

• Protein general information: Q14116  
  • Name: Interleukin 18 (IL 18) (Iboctadekin) (Interferon gamma inducing factor) (IFN gamma inducing factor) (Interleukin 1 gamma) (IL 1 gamma)
  • Length: 193  
  • Mass: 22,326
• Sequence:

  MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCR
  DNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQ
  FESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED

• Structural information:
  • Interpro: IPR015529  IPR000975  IPR008996  
  • PDB: 1J0S 2VXT 3F62 3WO2 3WO3 3WO4 4EEE 4EKX 4HJJ 4R6U 4XFS 4XFT 4XFU
  • PDBsum: 1J0S 2VXT 3F62 3WO2 3WO3 3WO4 4EEE 4EKX 4HJJ 4R6U 4XFS 4XFT 4XFU
  • DIP: 3785
  • STRING: ENSP00000280357
• Other Databases: GeneCards:  IL18  Malacards:  IL18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	IMP	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006954	inflammatory response	IDA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0030101	natural killer cell activation	IEA	biological process
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0030431	sleep	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042033	chemokine biosynthetic process	TAS	biological process
GO:0042088	T-helper 1 type immune response	IDA	biological process
GO:0042092	type 2 immune response	TAS	biological process
GO:0042094	interleukin-2 biosynthetic process	TAS	biological process
GO:0042095	interferon-gamma biosynthetic process	TAS	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042231	interleukin-13 biosynthetic process	TAS	biological process
GO:0042253	granulocyte macrophage colony-stimulating factor biosynthetic process	TAS	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IEA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0051142	positive regulation of NK T cell proliferation	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	TAS	molecular function
GO:0005125	cytokine activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0030101	natural killer cell activation	IEA	biological process
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0030431	sleep	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042033	chemokine biosynthetic process	TAS	biological process
GO:0042088	T-helper 1 type immune response	IDA	biological process
GO:0042092	type 2 immune response	TAS	biological process
GO:0042094	interleukin-2 biosynthetic process	TAS	biological process
GO:0042095	interferon-gamma biosynthetic process	IEA	biological process
GO:0042095	interferon-gamma biosynthetic process	TAS	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042231	interleukin-13 biosynthetic process	TAS	biological process
GO:0042253	granulocyte macrophage colony-stimulating factor biosynthetic process	TAS	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IEA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0051142	positive regulation of NK T cell proliferation	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0005125	cytokine activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006954	inflammatory response	IDA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0030431	sleep	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042033	chemokine biosynthetic process	TAS	biological process
GO:0042088	T-helper 1 type immune response	IDA	biological process
GO:0042092	type 2 immune response	TAS	biological process
GO:0042094	interleukin-2 biosynthetic process	TAS	biological process
GO:0042095	interferon-gamma biosynthetic process	TAS	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042231	interleukin-13 biosynthetic process	TAS	biological process
GO:0042253	granulocyte macrophage colony-stimulating factor biosynthetic process	TAS	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0051142	positive regulation of NK T cell proliferation	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071407	cellular response to organic cyclic compound	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04621	NOD-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway
hsa05323	Rheumatoid arthritis
hsa05321	Inflammatory bowel disease
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05135	Yersinia infection
hsa05134	Legionellosis
hsa05152	Tuberculosis
hsa05164	Influenza A
hsa05144	Malaria
hsa05143	African trypanosomiasis

Diseases

Associated diseases	References
Cancer	GAD: 15581980
Cancer (Adenocarcinoma)	GAD: 19692203
Cancer (cervical)	GAD: 18504197
Cancer (cholangiocarcinoma)	GAD: 19097518
Cancer (colorectal)	GAD: 18225542
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (Hepatocellular)	GAD: 19126646
Cancer (leiomyoma)	GAD: 17222831
Cancer (leukemia)	GAD: 19074885
Cancer (liver)	GAD: 15643599
Cancer (lung)	GAD: 19390575
Cancer (myeloma)	GAD: 20568250
Cancer (nasopharyngeal)	GAD: 18555694
Cancer (ovarian)	GAD: 15581980
Cancer (prostate)	GAD: 17688413
Cancer (Squamous cell)	GAD: 18940019
Cancer (stomach)	GAD: 16635219
Cancer (uterine cervical)	GAD: 18773860
Cancer (breast)	GAD: 19152241
Apoplexy	GAD: 20097272
Brain ischemia	GAD: 17981284
Cardiovascular disease	GAD: 18628791
Atherosclerosis	GAD: 16043644
Atrial fibrillation	GAD: 20490891
Hypertension	GAD: 19687159
Hyperandrogenism	GAD: 20964873
Graves disease	GAD: 16571086
Graves ophthalmopathy	GAD: 16571086
Choroidal neovascularization	GAD: 18235016
Sarcoidosis	GAD: 16053025
Hemophilia	GAD: 18781864
Mucocutaneous lymph node syndrome	GAD: 18484687
Hodgkin disease	GAD: 21061265
Aggressive periodontitis	GAD: 18983635
Allergy	GAD: 12532106
Arthritis	GAD: 20424918
Asthma	GAD: 12911784
Celiac disease	GAD: 16078996
Rheumatoid arthritis	GAD: 15896202
Systemic lupus erythematosus (SLE)	GAD: 19387647
Systemic lupus erythematosus (SLE)	GAD: 18683145
Allergic rhinitis	KEGG: H01360
Atopy	GAD: 15005726
Behcet's disease	GAD: 19796548
Behcet's disease	GAD: 17055358
Crohn's disease	GAD: 16306765
Hypersensitivity	GAD: 20304021
Metabolic syndrome	GAD: 19176284
Diabetes	GAD: 12401730
Still's disease	GAD: 12424620
Giant cell arteritis	GAD: 20331879
Alzheimer's disease	GAD: 17299019
Chronic renal failure	GAD: 21085059
Abortion	GAD: 17922692
Chorioamnionitis	GAD: 20452482
Recurrent pregnancy loss (RPL)	GAD: 16584830
Adenomyosis	INFBASE: 19394601
Female infertility	INFBASE: 19855902
Endometriosis	INFBASE: 18295214
Preeclampsia	INFBASE: 23082474
Recurrent pregnancy loss (RPL)	INFBASE: 26368793
Polycystic ovary syndrome (PCOS)	INFBASE: 20964873
Female infertility	INFBASE: 26368793
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 15302292
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 15302292
Unexplained infertility	INFBASE: 17934309
Uterine receptivity	INFBASE: 17934309
Male factor infertility	MIK: 26648778
Implantation failure	INFBASE: 14711545
Genital tract infections	MIK: 16674600
Pulmonary fibrosis	GAD: 16971411
Rhinitis	GAD: 16406079
Eczema	GAD: 17517100
Dermatitis	GAD: 17517100
Atopic dermatitis	GAD: 20060272
Connective tissue diseases	GAD: 19527514
Chronic periodontitis	GAD: 19811440
Gingivitis	GAD: 18930181
Adult onset still's disease	KEGG: H01516
Lupus nephritis	GAD: 19074166
Male infertility	MIK: 21615452
Role in testicular development	MIK: 18299271
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 19909603

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26648778	Male infertility			82 (27 healthy controls, 55 infertile patients (22 patients with varicocele, 13 with idiopathic infertility) )	Male infertility	IL-1? IL-10 IL-18 TGF-?1 IFN-g IL-6
24333229	Male infertility			57 infertile and normal males	Male infertility
21615452	Male infertility			28 (25 nonobstructive azoospermic patients, 3 healthy controls)	Male infertility
19909603	Unexplained infertility			350 (175 IVF/intracytoplasmic sperm injection (ICSI) patients at the time of oocyte retrieval and the cycles were compared with a control group matched for age, number of previous attempts and type of assisted reproductive procedure (IVF or ICSI) in which	Male infertility	IL-18 MBL
16674600	Male infertility, genital tract infections			80 (18 fertile men, 17 infertile men with genital tract infections, 15 infertile men with varicocele, 6 with Klienfelter syndrome, 7 with cryptorchidism, 7 with mumps orchitis, 10 with idiopathic testicular lesions)	Male infertility	IL-18 IFN-gamma
18299271	Role in testicular development				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)