• Gene id: 3605

Gene Summary

• Gene Symbol: IL17A   Gene   UCSC   Ensembl
• Aliases: CTLA-8, CTLA8, IL-17, IL-17A, IL17
• Gene name: interleukin 17A
• Alternate names: interleukin-17A, cytotoxic T-lymphocyte-associated antigen 8, cytotoxic T-lymphocyte-associated protein 8, interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8),
• Gene location: 6p12.2 (52186386: 52190637)     Exons: 3     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2
• OMIM: 603149

Protein Summary

• Protein general information: Q16552  
  • Name: Interleukin 17A (IL 17) (IL 17A) (Cytotoxic T lymphocyte associated antigen 8) (CTLA 8)
  • Length: 155  
  • Mass: 17,504
• Sequence:

  MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWN
  LHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPI
  VHHVA

• Structural information:
  • Interpro: IPR029034  IPR020440  IPR010345  
  • PDB: 2VXS 4HR9 4HSA 4QHU 5HHV 5HHX 5HI3 5HI4 5HI5 5N92 5NAN 5VB9
  • PDBsum: 2VXS 4HR9 4HSA 4QHU 5HHV 5HHX 5HI3 5HI4 5HI5 5N92 5NAN 5VB9
  • DIP: 6014
  • STRING: ENSP00000344192
• Other Databases: GeneCards:  IL17A  Malacards:  IL17A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular function
GO:0005126	cytokine receptor binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008219	cell death	TAS	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0010940	positive regulation of necrotic cell death	IEA	biological process
GO:0032747	positive regulation of interleukin-23 production	IDA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0050832	defense response to fungus	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IEA	biological process
GO:0072537	fibroblast activation	IDA	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	TAS	molecular function
GO:0005126	cytokine receptor binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008219	cell death	TAS	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0010940	positive regulation of necrotic cell death	IEA	biological process
GO:0032747	positive regulation of interleukin-23 production	IDA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0050832	defense response to fungus	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IEA	biological process
GO:0072537	fibroblast activation	IDA	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IEA	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0005126	cytokine receptor binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008219	cell death	TAS	biological process
GO:0032747	positive regulation of interleukin-23 production	IDA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0072537	fibroblast activation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway
hsa05323	Rheumatoid arthritis
hsa05321	Inflammatory bowel disease

Diseases

Associated diseases	References
Cancer	GAD: 19904747
Gastric mucosa	GAD: 19724898
Cancer (breast)	GAD: 20418110
Cancer (endometrial)	INFBASE: 20074813
Cancer (gastric)	GAD: 19904747
Cardiovascular disease	GAD: 21062626
Arthritis	GAD: 19208686
Asthma	GAD: 19210369
Ulcerative colitis	GAD: 17828618
Multiple sclerosis	GAD: 18563468
Female infertility	INFBASE: 26259585
Endometriosis	INFBASE: 18079209
Unexplained infertility	INFBASE: 24368037
Varicocele	MIK: 24927491
Polycystic ovary syndrome (PCOS)	MIK: 24927491
Endometriosis	INFBASE: 25772772
Endometriosis	INFBASE: 24927491
Cryptorchidism	MIK: 28606200
Varicocele	MIK: 24927491
Endometriosis	MIK: 24927491
Polycystic ovary syndrome (PCOS)	MIK: 24927491

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24927491	Varicocele, endometriosis, PCOS				Male infertility, Female infertility
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq