• Gene id: 3604

Gene Summary

• Gene Symbol: TNFRSF9   Gene   UCSC   Ensembl
• Aliases: 4-1BB, CD137, CDw137, ILA
• Gene name: TNF receptor superfamily member 9
• Alternate names: tumor necrosis factor receptor superfamily member 9, 4-1BB ligand receptor, CD137 antigen, T cell antigen ILA, T-cell antigen 4-1BB homolog, homolog of mouse 4-1BB, induced by lymphocyte activation (ILA), interleukin-activated receptor, homolog of mouse Ly63, rec,
• Gene location: 1p36.23 (7941606: 7915870)     Exons: 9     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induc
• OMIM: 602250

Protein Summary

• Protein general information: Q07011  
  • Name: Tumor necrosis factor receptor superfamily member 9 (4 1BB ligand receptor) (CDw137) (T cell antigen 4 1BB homolog) (T cell antigen ILA) (CD antigen CD137)
  • Length: 255  
  • Mass: 27899
  • Tissue specificity: Expressed on the surface of activated T-cells.
• Sequence:

  MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTR
  KECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNG
  TKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFK
  QPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

• Structural information:
  • Interpro: IPR009030  IPR001368  IPR020413  IPR034020  
  • Prosite: PS00652 PS50050
  • CDD: cd13410
  • PDB: 6A3V 6A3W 6BWV 6CPR 6CU0 6MGP 6MHR 6MI2
  • PDBsum: 6A3V 6A3W 6BWV 6CPR 6CU0 6MGP 6MHR 6MI2
  • DIP: 3021
  • STRING: ENSP00000478699
• Other Databases: GeneCards:  TNFRSF9  Malacards:  TNFRSF9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001183	negative regulation of interleukin-12 secretion	IBA	biological process
GO:2001180	negative regulation of interleukin-10 secretion	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0019955	cytokine binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq