• Gene id: 3601

Gene Summary

• Gene Symbol: IL15RA   Gene   UCSC   Ensembl
• Aliases: CD215
• Gene name: interleukin 15 receptor subunit alpha
• Alternate names: interleukin-15 receptor subunit alpha, interleukin 15 receptor alpha isoform EM2, interleukin 15 receptor alpha isoform IC2, interleukin 15 receptor alpha isoform IC3, interleukin 15 receptor alpha isoform IC4, interleukin 15 receptor alpha isoform IC5, interle,
• Gene location: 10p15.1 (5978740: 5948896)     Exons: 13     NC_000010.11
• Gene summary(Entrez): This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and
• OMIM: 601070

Protein Summary

• Protein general information: Q13261  
  • Name: Interleukin 15 receptor subunit alpha (IL 15 receptor subunit alpha) (IL 15R alpha) (IL 15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin 15 receptor subunit alpha (sIL 15 receptor subunit alpha) (sIL 15R alpha) (sIL 15RA)]
  • Length: 267  
  • Mass: 28233
  • Tissue specificity: Expressed in neutrophils (at protein level) (PubMed
• Sequence:

  MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTEC
  VLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGS
  QLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLA
  CYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL

• Structural information:
  • Protein Domains: (31..9-)
    (/note="Sushi-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302"-)
  • Interpro: IPR042372  IPR035976  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • PDB: 2ERS 2Z3Q 2Z3R 4GS7
  • PDBsum: 2ERS 2Z3Q 2Z3R 4GS7
• Other Databases: GeneCards:  IL15RA  Malacards:  IL15RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042010	interleukin-15 receptor activity	IBA	molecular function
GO:0035723	interleukin-15-mediated signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0035723	interleukin-15-mediated signaling pathway	IEA	biological process
GO:0042010	interleukin-15 receptor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035723	interleukin-15-mediated signaling pathway	TAS	biological process
GO:0005768	endosome	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031965	nuclear membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0042010	interleukin-15 receptor activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0004896	cytokine receptor activity	TAS	molecular function
GO:0035723	interleukin-15-mediated signaling pathway	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0050766	positive regulation of phagocytosis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04060	Cytokine-cytokine receptor interaction
hsa05166	Human T-cell leukemia virus 1 infection
hsa04630	JAK-STAT signaling pathway
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq