• Gene id: 3600

Gene Summary

• Gene Symbol: IL15   Gene   UCSC   Ensembl
• Aliases: IL-15
• Gene name: interleukin 15
• Alternate names: interleukin-15,
• Gene location: 4q31.21 (21384018: 21351471)     Exons: 27     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may
• OMIM: 600554

Protein Summary

• Protein general information: P40933  
  • Name: Interleukin 15 (IL 15)
  • Length: 162  
  • Mass: 18086
  • Tissue specificity: Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
• Sequence:

  MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYT
  ESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQS
  FVHIVQMFINTS

• Structural information:
  • Interpro: IPR009079  IPR020439  IPR003443  IPR038327  IPR020466  
  • PDB: 2XQB 2Z3Q 2Z3R 4GS7
  • PDBsum: 2XQB 2Z3Q 2Z3R 4GS7
  • DIP: 3046
  • STRING: ENSP00000296545
• Other Databases: GeneCards:  IL15  Malacards:  IL15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030225	macrophage differentiation	IDA	biological process
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0005126	cytokine receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0035723	interleukin-15-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071305	cellular response to vitamin D	IEA	biological process
GO:0030212	hyaluronan metabolic process	IEA	biological process
GO:0014732	skeletal muscle atrophy	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0050778	positive regulation of immune response	IEA	biological process
GO:0045580	regulation of T cell differentiation	IEA	biological process
GO:0045062	extrathymic T cell selection	IEA	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0001866	NK T cell proliferation	IEA	biological process
GO:1904100	positive regulation of protein O-linked glycosylation	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0050691	regulation of defense response to virus by host	IEA	biological process
GO:0048535	lymph node development	IEA	biological process
GO:0048469	cell maturation	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0032825	positive regulation of natural killer cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0035723	interleukin-15-mediated signaling pathway	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0035723	interleukin-15-mediated signaling pathway	IDA	biological process
GO:0050766	positive regulation of phagocytosis	IDA	biological process
GO:0042119	neutrophil activation	IDA	biological process
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04060	Cytokine-cytokine receptor interaction
hsa05166	Human T-cell leukemia virus 1 infection
hsa04630	JAK-STAT signaling pathway
hsa04668	TNF signaling pathway
hsa05323	Rheumatoid arthritis
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Pleurisy	PMID:10823416
Adult respiratory distress syndrome	PMID:21062445
pulmonary sarcoidosis	PMID:11742275
Arteriosclerosis	PMID:11485899
Asthma	PMID:15131572
Coronary artery disease	PMID:16109314
Brain infarction	PMID:16109314
Pulmonary fibrosis	PMID:21309737
Lung disease	PMID:17784951
type 1 diabetes mellitus	PMID:16098919
type 1 diabetes mellitus	PMID:17670937
obesity	PMID:18697873
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881