• Gene id: 3598

Gene Summary

• Gene Symbol: IL13RA2   Gene   UCSC   Ensembl
• Aliases: CD213A2, CT19, IL-13R, IL13BP
• Gene name: interleukin 13 receptor subunit alpha 2
• Alternate names: interleukin-13 receptor subunit alpha-2, IL-13 receptor subunit alpha-2, IL-13R subunit alpha-2, IL-13R-alpha-2, IL-13RA2, cancer/testis antigen 19, interleukin 13 binding protein, interleukin 13 receptor alpha 2 chain, interleukin 13 receptor, alpha 2,
• Gene location: Xq23 (115017615: 115003981)     Exons: 10     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reporte
• OMIM: 300130

SNPs

rs2057951

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.31334059A>G
NC_000022.10   g.31730045A>G|SEQ=[A/G]|GENE=PATZ1
PIK3IP1-DT   101929760

Protein Summary

• Protein general information: Q14627  
  • Name: Interleukin 13 receptor subunit alpha 2 (IL 13 receptor subunit alpha 2) (IL 13R subunit alpha 2) (IL 13R alpha 2) (IL 13RA2) (Interleukin 13 binding protein) (CD antigen CD213a2)
  • Length: 380  
  • Mass: 44176
• Sequence:

  MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRN
  IGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKVQDMDCVYYNW
  QYLLCSWKPGIGVLLDTNYNLFYWYEGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRS
  SYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE
  TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTGLLLRKPNTYPKMIPE
  FFCDT

• Structural information:
  • Protein Domains: (34..13-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (139..23-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (240..33-)
    3 (/note="Fibronectin-type-III)
    (/ev-)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR003532  IPR015321  
  • Prosite: PS50853 PS01356
  • PDB: 3LB6
  • PDBsum: 3LB6
  • DIP: 3340
  • STRING: ENSP00000361004
• Other Databases: GeneCards:  IL13RA2  Malacards:  IL13RA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019955	cytokine binding	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002638	negative regulation of immunoglobulin production	IEA	biological process
GO:0043305	negative regulation of mast cell degranulation	IEA	biological process
GO:0016064	immunoglobulin mediated immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004896	cytokine receptor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
oral squamous cell carcinoma	PMID:19065664
Cardiomyopathy	PMID:18362439
Breast cancer	PMID:11748276
Breast cancer	PMID:17438063
pancreatic cancer	PMID:11748276
Asthma	PMID:21462799
Atopic dermatitis	PMID:21462799
Pulmonary hypertension	PMID:20522789
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray