• Gene id: 3597

Gene Summary

• Gene Symbol: IL13RA1   Gene   UCSC   Ensembl
• Aliases: CD213A1, CT19, IL-13Ra, NR4
• Gene name: interleukin 13 receptor subunit alpha 1
• Alternate names: interleukin-13 receptor subunit alpha-1, CD213a1 antigen, IL-13 receptor subunit alpha-1, IL-13R subunit alpha-1, IL13 receptor alpha-1 chain, cancer/testis antigen 19, interleukin 13 receptor, alpha 1,
• Gene location: Xq24 (13150410: 13154910)     Exons: 2     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 rece
• OMIM: 300119

Protein Summary

• Protein general information: P78552  
  • Name: Interleukin 13 receptor subunit alpha 1 (IL 13 receptor subunit alpha 1) (IL 13R subunit alpha 1) (IL 13R alpha 1) (IL 13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
  • Length: 427  
  • Mass: 48760
  • Tissue specificity: Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
• Sequence:

  MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQD
  KKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGR
  NTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSR
  VKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVP
  GVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAIIVLLLYLKRLKIIIF
  PPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIENLKKASQ

• Structural information:
  • Protein Domains: (34..12-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (128..22-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (227..33-)
    3 (/note="Fibronectin-type-III)
    (/ev-)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR040566  IPR003532   IPR015321  
  • Prosite: PS50853 PS01356
  • CDD: cd00063
  • PDB: 3BPN 3BPO 4HWB 5E4E
  • PDBsum: 3BPN 3BPO 4HWB 5E4E
  • DIP: 3225
  • STRING: ENSP00000360730
• Other Databases: GeneCards:  IL13RA1  Malacards:  IL13RA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043235	receptor complex	IBA	cellular component
GO:0019955	cytokine binding	IBA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019976	interleukin-2 binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005898	interleukin-13 receptor complex	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Asthma	PMID:17006604
Chronic obstructive pulmonary disease	PMID:19796199
Atopic dermatitis	PMID:14527737
Pulmonary hypertension	PMID:20808962
Psoriasis	PMID:14527737
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq