• Gene id: 3592

Gene Summary

• Gene Symbol: IL12A   Gene   UCSC   Ensembl
• Aliases: CLMF, IL-12A, NFSK, NKSF1, P35
• Gene name: interleukin 12A
• Alternate names: interleukin-12 subunit alpha, CLMF p35, IL-12, subunit p35, IL35 subunit, NF cell stimulatory factor chain 1, NK cell stimulatory factor chain 1, cytotoxic lymphocyte maturation factor 1, p35, cytotoxic lymphocyte maturation factor 35 kDa subunit, interle,
• Gene location: 3q25.33 (159988835: 159996018)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that
• OMIM: 161560

Protein Summary

• Protein general information: P29459  
  • Name: Interleukin 12 subunit alpha (IL 12A) (Cytotoxic lymphocyte maturation factor 35 kDa subunit) (CLMF p35) (IL 12 subunit p35) (NK cell stimulatory factor chain 1) (NKSF1)
  • Length: 219  
  • Mass: 24,874
  • Tissue specificity: Widely expressed in multiple tissues and cell lines. {ECO
• Sequence:

  MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDIT
  KDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPK
  RQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

• Structural information:
  • Interpro: IPR009079  IPR004281  
  • PDB: 1F45 3HMX
  • PDBsum: 1F45 3HMX
  • DIP: 3772
  • STRING: ENSP00000303231
• Other Databases: GeneCards:  IL12A  Malacards:  IL12A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001916	positive regulation of T cell mediated cytotoxicity	IDA	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	IDA	biological process
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	biological process
GO:0005143	interleukin-12 receptor binding	IBA	molecular function
GO:0005143	interleukin-12 receptor binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0009615	response to virus	IEP	biological process
GO:0010224	response to UV-B	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032700	negative regulation of interleukin-17 production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032816	positive regulation of natural killer cell activation	IDA	biological process
GO:0032946	positive regulation of mononuclear cell proliferation	IMP	biological process
GO:0034393	positive regulation of smooth muscle cell apoptotic process	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0042163	interleukin-12 beta subunit binding	IPI	molecular function
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042832	defense response to protozoan	IEA	biological process
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0043514	interleukin-12 complex	NAS	cellular component
GO:0043514	interleukin-12 complex	NAS	cellular component
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0045513	interleukin-27 binding	IPI	molecular function
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IDA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEP	biological process
GO:0051135	positive regulation of NK T cell activation	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IMP	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0008083	growth factor activity	NAS	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0001916	positive regulation of T cell mediated cytotoxicity	IDA	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	IDA	biological process
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005143	interleukin-12 receptor binding	IEA	molecular function
GO:0005143	interleukin-12 receptor binding	IBA	molecular function
GO:0005143	interleukin-12 receptor binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0009615	response to virus	IEP	biological process
GO:0010224	response to UV-B	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032700	negative regulation of interleukin-17 production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032816	positive regulation of natural killer cell activation	IDA	biological process
GO:0032946	positive regulation of mononuclear cell proliferation	IMP	biological process
GO:0034393	positive regulation of smooth muscle cell apoptotic process	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0042163	interleukin-12 beta subunit binding	IEA	molecular function
GO:0042163	interleukin-12 beta subunit binding	IPI	molecular function
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0042832	defense response to protozoan	IEA	biological process
GO:0043514	interleukin-12 complex	IEA	cellular component
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0043514	interleukin-12 complex	NAS	cellular component
GO:0043514	interleukin-12 complex	NAS	cellular component
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0045513	interleukin-27 binding	IPI	molecular function
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IDA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEP	biological process
GO:0051135	positive regulation of NK T cell activation	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IMP	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0008083	growth factor activity	NAS	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0001916	positive regulation of T cell mediated cytotoxicity	IDA	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	IDA	biological process
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	biological process
GO:0005143	interleukin-12 receptor binding	IBA	molecular function
GO:0005143	interleukin-12 receptor binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0009615	response to virus	IEP	biological process
GO:0010224	response to UV-B	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032700	negative regulation of interleukin-17 production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032816	positive regulation of natural killer cell activation	IDA	biological process
GO:0032946	positive regulation of mononuclear cell proliferation	IMP	biological process
GO:0034393	positive regulation of smooth muscle cell apoptotic process	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0042163	interleukin-12 beta subunit binding	IPI	molecular function
GO:0042520	positive regulation of tyrosine phosphorylation of Stat4 protein	IDA	biological process
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0043514	interleukin-12 complex	NAS	cellular component
GO:0043514	interleukin-12 complex	NAS	cellular component
GO:0043514	interleukin-12 complex	IDA	cellular component
GO:0045513	interleukin-27 binding	IPI	molecular function
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IDA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEP	biological process
GO:0051135	positive regulation of NK T cell activation	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IMP	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0008083	growth factor activity	NAS	molecular function
GO:0008083	growth factor activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04620	Toll-like receptor signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa05200	Pathways in cancer
hsa05321	Inflammatory bowel disease
hsa05330	Allograft rejection
hsa04940	Type I diabetes mellitus
hsa05133	Pertussis
hsa05134	Legionellosis
hsa05152	Tuberculosis
hsa05162	Measles
hsa05164	Influenza A
hsa05168	Herpes simplex virus 1 infection
hsa05146	Amoebiasis
hsa05144	Malaria
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis
hsa05142	Chagas disease
hsa05143	African trypanosomiasis

Diseases

Associated diseases	References
Brill-Symmers disease	GAD: 17653830
Cancer	GAD: 14675394
Cancer (Adenocarcinoma)	GAD: 18628242
Cancer (bladder)	GAD: 16938461
Cancer (cervical)	GAD: 19012493
Cancer (colorectal)	GAD: 17062130
Cancer (esophageal)	GAD: 20453000
Cancer (Hepatocellular)	GAD: 19126646
Cancer (leukemia)	GAD: 19074885
Cancer (liver)	GAD: 15643599
Cancer (lung)	GAD: 17361014
Cancer (lymphoma)	GAD: 18633131
Cancer (melanoma)	GAD: 14675394
Cancer (breast)	GAD: 20418110
Cancer (myeloma)	GAD: 20568250
Cancer (nasopharyngeal)	GAD: 19148899
Cancer (stomach)	GAD: 16885196
Atherosclerosis	GAD: 20485444
Primary biliary cirrhosis	GAD: 19458352
Graves disease	GAD: 20960273
Graves ophthalmopathy	GAD: 19798110
Aplastic anemia	GAD: 14629328
Sarcoidosis	GAD: 21086908
Hodgkin disease	GAD: 19573080
Arthritis	GAD: 11981324
Atopy	GAD: 20060272
Autoimmune diseases	GAD: 20082482
Juvenile arthritis	GAD: 15170937
Multiple sclerosis	GAD: 16803996
Psoriasis	GAD: 17236132
Systemic lupus erythematosus (SLE)	GAD: 19031096
Scleroderma	GAD: 20603050
Asthma	GAD: 14962816
Celiac disease	GAD: 18805825
Common variable immunodeficiency	GAD: 19339796
Biliary cirrhosis	GAD: 20639880
Diabetes	GAD: 15361128
Biliary cirrhosis	GAD: 21399635
Myasthenia gravis	GAD: 17509455
Alzheimer's disease	GAD: 20213229
Chronic renal failure	GAD: 21085059
Abortion	GAD: 17922692
Endometriosis	INFBASE: 9506747
Preeclampsia	INFBASE: 24931237
Recurrent pregnancy loss (RPL)	INFBASE: 26368793
Polycystic ovary syndrome (PCOS)	INFBASE: 12798884
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 26823856
Uterine receptivity	INFBASE: 17934309
Male factor infertility	MIK: 11476770
Male subfertility	MIK: 19811461
Male factor infertility	MIK: 20576636
Leukocytospermia	MIK: 9730437
Unexplained infertility	MIK: 25032981
Female infertility	INFBASE: 23082474
IVF outcome	INFBASE: 17854532
Chorioamnionitis	GAD: 20452482
Immunoinfertility	MIK: 9639047
Implantation failure	INFBASE: 14711545
Pulmonary fibrosis	GAD: 16573560
Interstitial lung diseases	GAD: 19117745
Chronic obstructive pulmonary disease (COPD)	GAD: 18554158
Takayasu arteritis	GAD: 17002904
Takayasu arteritis	GAD: 16573560
Atopic dermatitis	GAD: 20060272
Pemphigus vulgaris	GAD: 19470040
Gingival hemorrhage	GAD: 18672993
Aphthous stomatitis	GAD: 14629328
Immunoinfertility	MIK: 9639047
Male factor infertility	MIK: 11476770
Leukocytospermia	MIK: 9730437
Male subfertility	MIK: 19811461
Unexplained infertility	MIK: 25032981

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20576636	Infertility			96 (male infertility, n = 61; female infertility factors, n = 35)	Male infertility, Female infertility
19811461	Subfertile men			77 male partners	Male infertility	IL-6 IL-10 TNF-alpha IFN-gamma
11476770	Male factor infertility			9 sperm donors	Male infertility	TYK 2 STAT 1 IFN-alpha IFN-gamma IL-12 TYK 2 STAT 4
9730437	Male infertility, leukocytospermia				Male infertility
25032981	Unexplained infertility			50 (30 with immune infertility, 20 controls)	Male infertility, Female infertility	IL-21 IL-12 and TNF?
9639047	Immunoinfertile, Male infertility			74 (33 fertile men, 27 male-factor-infertile, 14 immunoinfertile)	Male infertility	IL-12