• Gene id: 3589

Gene Summary

• Gene Symbol: IL11   Gene   UCSC   Ensembl
• Aliases: AGIF, IL-11
• Gene name: interleukin 11
• Alternate names: interleukin-11, adipogenesis inhibitory factor, oprelvekin,
• Gene location: 19q13.42 (55370462: 55364381)     Exons: 5     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cy
• OMIM: 147681

Protein Summary

• Protein general information: P20809  
  • Name: Interleukin 11 (IL 11) (Adipogenesis inhibitory factor) (AGIF) (Oprelvekin)
  • Length: 199  
  • Mass: 21,429
• Sequence:

  MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSL
  PTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALP
  QPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

• Structural information:
  • Interpro: IPR009079  IPR020438  IPR020412  
  • PDB: 4MHL
  • PDBsum: 4MHL
  • DIP: 3775
  • STRING: ENSP00000264563
• Other Databases: GeneCards:  IL11  Malacards:  IL11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IBA	molecular function
GO:0005142	interleukin-11 receptor binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IC	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0007267	cell-cell signaling	IC	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0030183	B cell differentiation	NAS	biological process
GO:0030219	megakaryocyte differentiation	NAS	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045444	fat cell differentiation	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046888	negative regulation of hormone secretion	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:1903659	regulation of complement-dependent cytotoxicity	IMP	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IMP	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005142	interleukin-11 receptor binding	IEA	molecular function
GO:0005142	interleukin-11 receptor binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IC	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0007267	cell-cell signaling	IC	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0030183	B cell differentiation	NAS	biological process
GO:0030219	megakaryocyte differentiation	NAS	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045444	fat cell differentiation	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046888	negative regulation of hormone secretion	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:1903659	regulation of complement-dependent cytotoxicity	IMP	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IMP	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005142	interleukin-11 receptor binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IC	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0007267	cell-cell signaling	IC	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0030183	B cell differentiation	NAS	biological process
GO:0030219	megakaryocyte differentiation	NAS	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045444	fat cell differentiation	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046888	negative regulation of hormone secretion	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:1903659	regulation of complement-dependent cytotoxicity	IMP	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04640	Hematopoietic cell lineage
hsa05323	Rheumatoid arthritis

Diseases

Associated diseases	References
Crohn's disease	GAD: 12486609
Ulcerative colitis	GAD: 12486609
Alzheimer's disease	GAD: 19141999
Blocking implantation	INFBASE: 19213836
Pelvic endometriosis	INFBASE: 11119747
Female infertility	INFBASE: 17000646
Polycystic ovary syndrome (PCOS)	INFBASE: 11574494
Lower implantation	INFBASE: 16705074
Unexplained infertility	INFBASE: 18047677
Male subfertility	MIK: 19811461
Decidualization	INFBASE: 15613426
Endometriosis	INFBASE: 16310857
Chronic obstructive pulmonary disease (COPD)	GAD: 15004839
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male subfertility	MIK: 19811461

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19811461	Subfertile men			76 male partners	Male infertility	IL-6 IL-10 TNF-alpha IFN-gamma
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq