• Gene id: 3588

Gene Summary

• Gene Symbol: IL10RB   Gene   UCSC   Ensembl
• Aliases: CDW210B, CRF2-4, CRFB4, D21S58, D21S66, IL-10R2
• Gene name: interleukin 10 receptor subunit beta
• Alternate names: interleukin-10 receptor subunit beta, IL-10 receptor subunit beta, IL-10R subunit 2, IL-10R subunit beta, IL-10RB, cytokine receptor class-II CRF2-4, cytokine receptor class-II member 4, cytokine receptor family 2 member 4, cytokine receptor family II, member 4, i,
• Gene location: 21q22.11 (33266366: 33297220)     Exons: 7     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal tra
• OMIM: 300332

Protein Summary

• Protein general information: Q08334  
  • Name: Interleukin 10 receptor subunit beta (IL 10 receptor subunit beta) (IL 10R subunit beta) (IL 10RB) (Cytokine receptor class II member 4) (Cytokine receptor family 2 member 4) (CRF2 4) (Interleukin 10 receptor subunit 2) (IL 10R subunit 2) (IL 10R2) (CD an
  • Length: 325  
  • Mass: 36995
• Sequence:

  MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECD
  FSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYN
  SWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAV
  ILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE
  DSESGKQNPGDSCSLGTPPGQGPQS

• Structural information:
  • Protein Domains: (23..11-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (114..21-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR015373  
  • Prosite: PS50853
  • CDD: cd00063
  • PDB: 3LQM 5T5W
  • PDBsum: 3LQM 5T5W
  • DIP: 6016
  • STRING: ENSP00000290200
• Other Databases: GeneCards:  IL10RB  Malacards:  IL10RB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0004920	interleukin-10 receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004920	interleukin-10 receptor activity	TAS	contributes to
GO:0032002	interleukin-28 receptor complex	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05163	Human cytomegalovirus infection
hsa05152	Tuberculosis
hsa04630	JAK-STAT signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq