• Gene id: 3587

Gene Summary

• Gene Symbol: IL10RA   Gene   UCSC   Ensembl
• Aliases: CD210, CD210a, CDW210A, HIL-10R, IL-10R1, IL10R
• Gene name: interleukin 10 receptor subunit alpha
• Alternate names: interleukin-10 receptor subunit alpha, IL-10 receptor subunit alpha, IL-10R subunit 1, IL-10R subunit alpha, IL-10RA, interleukin 10 receptor, alpha, interleukin-10 receptor alpha chain, interleukin-10 receptor subunit 1,
• Gene location: 11q23.3 (1984026: 1978916)     Exons: 9     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammator
• OMIM: 146933

Protein Summary

• Protein general information: Q13651  
  • Name: Interleukin 10 receptor subunit alpha (IL 10 receptor subunit alpha) (IL 10R subunit alpha) (IL 10RA) (CDw210a) (Interleukin 10 receptor subunit 1) (IL 10R subunit 1) (IL 10R1) (CD antigen CD210)
  • Length: 578  
  • Mass: 63003
  • Tissue specificity: Primarily expressed in hematopoetic cells including B-cells, T-cells, NK cells, monocytes and macrophages. Not expressed in non-hematopoetic cells such as fibroblasts or endothelial cells.
• Sequence:

  MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNC
  SQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKM
  APANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECIS
  LTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEA
  FLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDSGICLQ
  EPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQT
  RCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSL
  LALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE

• Structural information:
  • Interpro: IPR003961  IPR036116  IPR013783  
  • PDB: 1J7V 1LQS 1Y6K 1Y6M 1Y6N 5IXI
  • PDBsum: 1J7V 1LQS 1Y6K 1Y6M 1Y6N 5IXI
  • DIP: 3512
  • STRING: ENSP00000227752
• Other Databases: GeneCards:  IL10RA  Malacards:  IL10RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0010507	negative regulation of autophagy	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0070086	ubiquitin-dependent endocytosis	IDA	biological process
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004920	interleukin-10 receptor activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019969	interleukin-10 binding	IEA	molecular function
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004920	interleukin-10 receptor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05163	Human cytomegalovirus infection
hsa05152	Tuberculosis
hsa04630	JAK-STAT signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881