Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 3586
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol IL10   Gene   UCSC   Ensembl
Aliases CSIF, GVHDS, IL-10, IL10A, TGIF
Gene name interleukin 10
Alternate names interleukin-10, T-cell growth inhibitory factor, cytokine synthesis inhibitory factor,
Gene location 1q32.1 (206772493: 206767602)     Exons: 5     NC_000001.11
Gene summary(Entrez) The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class
OMIM 124092

Protein Summary
Protein general information P22301  

Name: Interleukin 10 (IL 10) (Cytokine synthesis inhibitory factor) (CSIF)

Length: 178  Mass: 20,517

Tissue specificity: Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland an

Sequence MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK
GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQ
EKGIYKAMSEFDIFINYIEAYMTMKIRN
Structural information
Interpro:  IPR009079  IPR000098  IPR020443  IPR020423  
Prosite:   PS00520

PDB:  		 1ILK 1INR 1J7V 1LK3 1Y6K 2H24 2ILK
PDBsum:   1ILK 1INR 1J7V 1LK3 1Y6K 2H24 2ILK

DIP:  
3511
MINT:  
STRING:   ENSP00000412237
Other Databases GeneCards:  IL10  Malacards:  IL10

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0002237 response to molecule of b
acterial origin
 IDA biological process
GO:0002740 negative regulation of cy
tokine secretion involved
in immune response
 IDA biological process
GO:0002875 negative regulation of ch
ronic inflammatory respon
se to antigenic stimulus
 IEA biological process
GO:0002904 positive regulation of B
cell apoptotic process
 IDA biological process
GO:0005125 cytokine activity
 IBA molecular function
GO:0005125 cytokine activity
 NAS molecular function
GO:0005141 interleukin-10 receptor b
inding
 IBA molecular function
GO:0005141 interleukin-10 receptor b
inding
 NAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005615 extracellular space
 IDA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0006954 inflammatory response
 IDA biological process
GO:0007253 cytoplasmic sequestering
of NF-kappaB
 NAS biological process
GO:0007267 cell-cell signaling
 IC biological process
GO:0007568 aging
 IEA biological process
GO:0008083 growth factor activity
 NAS molecular function
GO:0010468 regulation of gene expres
sion
 IDA biological process
GO:0014823 response to activity
 IEA biological process
GO:0014854 response to inactivity
 IEA biological process
GO:0030097 hemopoiesis
 TAS biological process
GO:0030183 B cell differentiation
 NAS biological process
GO:0030595 leukocyte chemotaxis
 TAS biological process
GO:0030886 negative regulation of my
eloid dendritic cell acti
vation
 IEA biological process
GO:0030889 negative regulation of B
cell proliferation
 IDA biological process
GO:0032689 negative regulation of in
terferon-gamma production
 IEA biological process
GO:0032692 negative regulation of in
terleukin-1 production
 TAS biological process
GO:0032695 negative regulation of in
terleukin-12 production
 TAS biological process
GO:0032701 negative regulation of in
terleukin-18 production
 TAS biological process
GO:0032715 negative regulation of in
terleukin-6 production
 IDA biological process
GO:0032715 negative regulation of in
terleukin-6 production
 TAS biological process
GO:0032717 negative regulation of in
terleukin-8 production
 TAS biological process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
 TAS biological process
GO:0032800 receptor biosynthetic pro
cess
 IDA biological process
GO:0032868 response to insulin
 IEA biological process
GO:0034465 response to carbon monoxi
de
 IEA biological process
GO:0035729 cellular response to hepa
tocyte growth factor stim
ulus
 IEA biological process
GO:0042092 type 2 immune response
 TAS biological process
GO:0042100 B cell proliferation
 NAS biological process
GO:0042130 negative regulation of T
cell proliferation
 NAS biological process
GO:0042130 negative regulation of T
cell proliferation
 NAS biological process
GO:0042493 response to drug
 IEA biological process
GO:0042536 negative regulation of tu
mor necrosis factor biosy
nthetic process
 IEA biological process
GO:0042742 defense response to bacte
rium
 IEA biological process
GO:0042832 defense response to proto
zoan
 IEA biological process
GO:0043066 negative regulation of ap
optotic process
 NAS biological process
GO:0044130 negative regulation of gr
owth of symbiont in host
 IEA biological process
GO:0045019 negative regulation of ni
tric oxide biosynthetic p
rocess
 IEA biological process
GO:0045191 regulation of isotype swi
tching
 NAS biological process
GO:0045347 negative regulation of MH
C class II biosynthetic p
rocess
 TAS biological process
GO:0045348 positive regulation of MH
C class II biosynthetic p
rocess
 IEA biological process
GO:0045355 negative regulation of in
terferon-alpha biosynthet
ic process
 NAS biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological process
GO:0046427 positive regulation of JA
K-STAT cascade
 IBA biological process
GO:0050715 positive regulation of cy
tokine secretion
 IDA biological process
GO:0051045 negative regulation of me
mbrane protein ectodomain
proteolysis
 IDA biological process
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
 IDA biological process
GO:0051384 response to glucocorticoi
d
 IDA biological process
GO:0051930 regulation of sensory per
ception of pain
 IEA biological process
GO:0060302 negative regulation of cy
tokine activity
 IMP biological process
GO:0060670 branching involved in lab
yrinthine layer morphogen
esis
 IEA biological process
GO:0071222 cellular response to lipo
polysaccharide
 NAS biological process
GO:0071392 cellular response to estr
adiol stimulus
 IEA biological process
GO:0071650 negative regulation of ch
emokine (C-C motif) ligan
d 5 production
 TAS biological process
GO:1903659 regulation of complement-
dependent cytotoxicity
 IMP biological process
GO:2000352 negative regulation of en
dothelial cell apoptotic
process
 IMP biological process
GO:0001818 negative regulation of cy
tokine production
 IEA biological process
GO:0002237 response to molecule of b
acterial origin
 IDA biological process
GO:0002740 negative regulation of cy
tokine secretion involved
in immune response
 IDA biological process
GO:0002875 negative regulation of ch
ronic inflammatory respon
se to antigenic stimulus
 IEA biological process
GO:0002904 positive regulation of B
cell apoptotic process
 IDA biological process
GO:0005125 cytokine activity
 IEA molecular function
GO:0005125 cytokine activity
 IEA molecular function
GO:0005125 cytokine activity
 IBA molecular function
GO:0005125 cytokine activity
 IEA molecular function
GO:0005125 cytokine activity
 NAS molecular function
GO:0005141 interleukin-10 receptor b
inding
 IEA molecular function
GO:0005141 interleukin-10 receptor b
inding
 IBA molecular function
GO:0005141 interleukin-10 receptor b
inding
 NAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005576 extracellular region
 IEA cellular component
GO:0005576 extracellular region
 IEA cellular component
GO:0005576 extracellular region
 IEA cellular component
GO:0005615 extracellular space
 IEA cellular component
GO:0005615 extracellular space
 IEA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0006954 inflammatory response
 IDA biological process
GO:0006955 immune response
 IEA biological process
GO:0006955 immune response
 IEA biological process
GO:0007253 cytoplasmic sequestering
of NF-kappaB
 NAS biological process
GO:0007267 cell-cell signaling
 IC biological process
GO:0007568 aging
 IEA biological process
GO:0008083 growth factor activity
 NAS molecular function
GO:0010033 response to organic subst
ance
 IEA biological process
GO:0010468 regulation of gene expres
sion
 IDA biological process
GO:0014823 response to activity
 IEA biological process
GO:0014854 response to inactivity
 IEA biological process
GO:0030097 hemopoiesis
 TAS biological process
GO:0030183 B cell differentiation
 NAS biological process
GO:0030595 leukocyte chemotaxis
 TAS biological process
GO:0030886 negative regulation of my
eloid dendritic cell acti
vation
 IEA biological process
GO:0030889 negative regulation of B
cell proliferation
 IDA biological process
GO:0032496 response to lipopolysacch
aride
 IEA biological process
GO:0032689 negative regulation of in
terferon-gamma production
 IEA biological process
GO:0032692 negative regulation of in
terleukin-1 production
 TAS biological process
GO:0032695 negative regulation of in
terleukin-12 production
 IEA biological process
GO:0032695 negative regulation of in
terleukin-12 production
 TAS biological process
GO:0032701 negative regulation of in
terleukin-18 production
 TAS biological process
GO:0032715 negative regulation of in
terleukin-6 production
 IDA biological process
GO:0032715 negative regulation of in
terleukin-6 production
 TAS biological process
GO:0032717 negative regulation of in
terleukin-8 production
 TAS biological process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
 IEA biological process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
 TAS biological process
GO:0032800 receptor biosynthetic pro
cess
 IDA biological process
GO:0032868 response to insulin
 IEA biological process
GO:0034465 response to carbon monoxi
de
 IEA biological process
GO:0035729 cellular response to hepa
tocyte growth factor stim
ulus
 IEA biological process
GO:0042092 type 2 immune response
 TAS biological process
GO:0042100 B cell proliferation
 NAS biological process
GO:0042130 negative regulation of T
cell proliferation
 NAS biological process
GO:0042130 negative regulation of T
cell proliferation
 NAS biological process
GO:0042493 response to drug
 IEA biological process
GO:0042536 negative regulation of tu
mor necrosis factor biosy
nthetic process
 IEA biological process
GO:0042742 defense response to bacte
rium
 IEA biological process
GO:0042832 defense response to proto
zoan
 IEA biological process
GO:0043066 negative regulation of ap
optotic process
 IEA biological process
GO:0043066 negative regulation of ap
optotic process
 NAS biological process
GO:0044130 negative regulation of gr
owth of symbiont in host
 IEA biological process
GO:0045019 negative regulation of ni
tric oxide biosynthetic p
rocess
 IEA biological process
GO:0045191 regulation of isotype swi
tching
 NAS biological process
GO:0045347 negative regulation of MH
C class II biosynthetic p
rocess
 TAS biological process
GO:0045348 positive regulation of MH
C class II biosynthetic p
rocess
 IEA biological process
GO:0045355 negative regulation of in
terferon-alpha biosynthet
ic process
 NAS biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological process
GO:0046427 positive regulation of JA
K-STAT cascade
 IBA biological process
GO:0050715 positive regulation of cy
tokine secretion
 IDA biological process
GO:0050728 negative regulation of in
flammatory response
 IEA biological process
GO:0051045 negative regulation of me
mbrane protein ectodomain
proteolysis
 IDA biological process
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
 IDA biological process
GO:0051384 response to glucocorticoi
d
 IEA biological process
GO:0051384 response to glucocorticoi
d
 IDA biological process
GO:0051930 regulation of sensory per
ception of pain
 IEA biological process
GO:0060302 negative regulation of cy
tokine activity
 IMP biological process
GO:0060670 branching involved in lab
yrinthine layer morphogen
esis
 IEA biological process
GO:0071222 cellular response to lipo
polysaccharide
 IEA biological process
GO:0071222 cellular response to lipo
polysaccharide
 NAS biological process
GO:0071392 cellular response to estr
adiol stimulus
 IEA biological process
GO:0071650 negative regulation of ch
emokine (C-C motif) ligan
d 5 production
 TAS biological process
GO:1903659 regulation of complement-
dependent cytotoxicity
 IMP biological process
GO:2000352 negative regulation of en
dothelial cell apoptotic
process
 IMP biological process
GO:0002237 response to molecule of b
acterial origin
 IDA biological process
GO:0002740 negative regulation of cy
tokine secretion involved
in immune response
 IDA biological process
GO:0002904 positive regulation of B
cell apoptotic process
 IDA biological process
GO:0005125 cytokine activity
 IBA molecular function
GO:0005125 cytokine activity
 NAS molecular function
GO:0005141 interleukin-10 receptor b
inding
 IBA molecular function
GO:0005141 interleukin-10 receptor b
inding
 NAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005615 extracellular space
 IDA cellular component
GO:0006954 inflammatory response
 IDA biological process
GO:0007253 cytoplasmic sequestering
of NF-kappaB
 NAS biological process
GO:0007267 cell-cell signaling
 IC biological process
GO:0008083 growth factor activity
 NAS molecular function
GO:0010468 regulation of gene expres
sion
 IDA biological process
GO:0030097 hemopoiesis
 TAS biological process
GO:0030183 B cell differentiation
 NAS biological process
GO:0030595 leukocyte chemotaxis
 TAS biological process
GO:0030889 negative regulation of B
cell proliferation
 IDA biological process
GO:0032692 negative regulation of in
terleukin-1 production
 TAS biological process
GO:0032695 negative regulation of in
terleukin-12 production
 TAS biological process
GO:0032701 negative regulation of in
terleukin-18 production
 TAS biological process
GO:0032715 negative regulation of in
terleukin-6 production
 IDA biological process
GO:0032715 negative regulation of in
terleukin-6 production
 TAS biological process
GO:0032717 negative regulation of in
terleukin-8 production
 TAS biological process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
 TAS biological process
GO:0032800 receptor biosynthetic pro
cess
 IDA biological process
GO:0042092 type 2 immune response
 TAS biological process
GO:0042100 B cell proliferation
 NAS biological process
GO:0042130 negative regulation of T
cell proliferation
 NAS biological process
GO:0042130 negative regulation of T
cell proliferation
 NAS biological process
GO:0043066 negative regulation of ap
optotic process
 NAS biological process
GO:0045191 regulation of isotype swi
tching
 NAS biological process
GO:0045347 negative regulation of MH
C class II biosynthetic p
rocess
 TAS biological process
GO:0045355 negative regulation of in
terferon-alpha biosynthet
ic process
 NAS biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0046427 positive regulation of JA
K-STAT cascade
 IBA biological process
GO:0050715 positive regulation of cy
tokine secretion
 IDA biological process
GO:0051045 negative regulation of me
mbrane protein ectodomain
proteolysis
 IDA biological process
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
 IDA biological process
GO:0051384 response to glucocorticoi
d
 IDA biological process
GO:0060302 negative regulation of cy
tokine activity
 IMP biological process
GO:0071222 cellular response to lipo
polysaccharide
 NAS biological process
GO:0071650 negative regulation of ch
emokine (C-C motif) ligan
d 5 production
 TAS biological process
GO:1903659 regulation of complement-
dependent cytotoxicity
 IMP biological process
GO:2000352 negative regulation of en
dothelial cell apoptotic
process
 IMP biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04068FoxO signaling pathway
hsa04060Cytokine-cytokine receptor interaction
hsa04061Viral protein interaction with cytokine and cytokine receptor
hsa04625C-type lectin receptor signaling pathway
hsa04660T cell receptor signaling pathway
hsa04672Intestinal immune network for IgA production
hsa05310Asthma
hsa05322Systemic lupus erythematosus
hsa05320Autoimmune thyroid disease
hsa05321Inflammatory bowel disease
hsa05330Allograft rejection
hsa05135Yersinia infection
hsa05133Pertussis
hsa05150Staphylococcus aureus infection
hsa05152Tuberculosis
hsa05146Amoebiasis
hsa05144Malaria
hsa05145Toxoplasmosis
hsa05140Leishmaniasis
hsa05142Chagas disease
hsa05143African trypanosomiasis

Diseases

Expand All | Collapse All
Associated diseases References
Brill-Symmers disease GAD: 20578820
Cancer GAD: 15709194
Cancer (Adenocarcinoma) GAD: 18628242
Cancer (Adenoma) GAD: 16537707
Cancer (basal cell) GAD: 17107380
Chronic lymphocytic leukemia GAD: 19573080
Cancer (B-Cell lymphomas) GAD: 14701701
Cancer (Biliary tract neoplasms) GAD: 18676870
Cancer (bladder) GAD: 16938461
Cancer (Central nervous system) GAD: 20299965
Cancer (cervical) GAD: 18337305
Cancer (colon) GAD: 18628251
Cancer (colorectal) GAD: 17454884
Cancer (epithelial ovarian) GAD: 19064572
Cancer (esophageal) GAD: 19801321
Cancer (gastric) GAD: 11756988
Cancer (Hepatocellular) GAD: 19126646
Cancer (kidney) GAD: 15784411
Cancer (leukemia) GAD: 15932621
Cancer (liver) GAD: 15763337
Cancer (lung) GAD: 18676680
Cancer (lymphoma) GAD: 16971956
Cancer (melanoma) GAD: 15709194
Cancer (mouth) GAD: 17980158
Cancer (myeloma) GAD: 18997828
Cancer (nasopharyngeal) GAD: 18312596
Cancer (noncardia gastric) GAD: 14753224
Cancer (non-Hodgkin lymphoma) GAD: 16449530
Cancer (non-melanoma skin cancer) GAD: 15914210
Cancer (osteosarcoma) GAD: 17483704
Cancer (ovarian) GAD: 15581980
Cancer (Papilary) GAD: 18997484
Cancer (prostate) GAD: 16284379
Cancer (Renal cell) GAD: 19027043
Cancer (Squamous cell) GAD: 12535204
Cancer (stomach) GAD: 15127646
Cancer (testicular) GAD: 17220333
Cancer (breast) GAD: 15931634
Aneurysm GAD: 20302034
Angina pectoris GAD: 19005292
Aortic stenosis GAD: 15039132
Atherosclerosis GAD: 16313808
Atherosclerosis GAD: 16331571
Atrial fibrillation GAD: 20490891
Brain ischemia GAD: 19028820
Cerebrovascular disease GAD: 17460178
Hypertension GAD: 16323614
Myocardial Infarction GAD: 16184405
Cardiovascular disease GAD: 16184405
Carotid artery diseases GAD: 16804000
Thromboembolism GAD: 17113632
Omenn syndrome severe combined immunideficiency GAD: 17572155
Fabry disease GAD: 17353161
Bronchopulmonary dysplasia GAD: 15678510
Cystic fibrosis GAD: 17336597
Irritable bowel syndrome GAD: 16780675
Gallbladder diseases GAD: 19065724
Gastric disease GAD: 19295440
Primary biliary cirrhosis GAD: 15562761
Liver disease GAD: 15225432
Hyperparathyroidism GAD: 20424473
Graves disease GAD: 19882211
Ophthalmia GAD: 16249504
Chorioretinitis GAD: 18436829
Choroidal neovascularization GAD: 18235016
Corneal diseases GAD: 19450443
Macular degeneration GAD: 18310311
Uveitis GAD: 16024856
Retinal artery occlusion GAD: 17438520
AHG deficiency disease GAD: 20082647
Anemia GAD: 18972133
Aplastic anemia GAD: 14629328
Eosinophilia GAD: 11668616
Hemophilia GAD: 16380445
Sarcoidosis GAD: 11436536
Mucocutaneous lymph node syndrome GAD: 19543506
Hodgkin disease GAD: 17496310
Idiopathic thrombocytopenic purpura GAD: 15755291
Kawasaki disease GAD: 14744383
Allergic rhinitis GAD: 15120189
Ankylosing spondylitis GAD: 20030788
Arthritis GAD: 11315919
Asthma GAD: 19264973
Atopy GAD: 15007355
Autoimmune diseases GAD: 20082482
Autoimmune diseases GAD: 15161508
Behcet's disease GAD: 19796538
Bullous pemphigoid GAD: 16403098
Ulcerative colitis GAD: 18569989
Chronic ulcerative colitis GAD: 20509889
Churg-Strauss Syndrome GAD: 18512809
Crohn's disease GAD: 16165702
Sjogren's syndrome GAD: 11212157
Juvenile arthritis GAD: 12195624
Ulcerative colitis GAD: 19861958
Rheumatoid arthritis GAD: 11085795
Multiple sclerosis GAD: 14616291
Psoriasis GAD: 11298547
Psoriatic arthritis GAD: 17388919
Scleroderma GAD: 18576303
Systemic lupus erythematosus (SLE) GAD: 18397303
Systemic lupus erythematosus (SLE) GAD: 12126589
Anaphylaxis KEGG: H01359
Behcet's disease KEGG: H01476
Celiac disease GAD: 15979955
Inflammatory bowel disease GAD: 15842590
Hypersensitivity GAD: 18440625
Biliary atresia GAD: 12100571
Diabetes GAD: 12121678
Fatty liver GAD: 19401628
Hypercholesterolemia GAD: 20602615
Metabolic syndrome GAD: 19056482
Obesity GAD: 19798061
Bone diseases GAD: 15927351
Bone diseases GAD: 15607028
Degenerative arthropathy GAD: 16078336
Reactive arthritis GAD: 11352256
Osteolysis GAD: 19860911
Knee osteoarthritis GAD: 19934104
Dermatomyositis GAD: 16895750
Rheumatic diseases GAD: 16043936
Paraparesis GAD: 15346339
Migraine disorder GAD: 19559392
Giant cell arteritis GAD: 17552041
Myasthenia gravis GAD: 17509455
Guillain-Barre syndrome GAD: 12799024
Alzheimer's disease GAD: 19889475
Brain hypoxia GAD: 20863526
Parkinson disease GAD: 18362084
Cerebral palsy GAD: 19238444
Chronic fatigue syndrome GAD: 16762155
Mood disorders GAD: 19890236
Major depressive disorder GAD: 19087313
Schizophrenia GAD: 14563376
Albuminuria GAD: 21054877
Chronic renal failure GAD: 20551628
Kidney diseases GAD: 15104679
Kidney diseases GAD: 11544437
Abortion GAD: 20587610
Chorioamnionitis GAD: 20452482
Preeclampsia GAD: 19407822
Miscarriage GAD: 19778488
Preeclampsia GAD: 16433832
Prostatic hyperplasia GAD: 16461080
Prostatitis GAD: 19157224
Recurrent pregnancy loss (RPL) GAD: 15214940
Recurrent pregnancy loss (RPL) GAD: 15214940
Preterm birth risk GAD: 19375805
Tubal factor infertility GAD: 12151439
Tubal factor infertility GAD: 12151439
Preterm birth risk GAD: 17145371
Spontaneous abortion GAD: 15042002
Adenomyosis INFBASE: 18439592
Female infertility INFBASE: 18439592
Premature ovarian insufficiency (POI) INFBASE: 22342295
Pelvic endometriosis INFBASE: 26871558
Deep infiltrating endometriosis INFBASE: 11327093
Endometriosis INFBASE: 9065123
Female infertility INFBASE: 23553197
Implantation failure INFBASE: 12615834
Recurrent implantation failure (RIF) INFBASE: 12615834
Recurrent implantation failure (RIF) INFBASE: 22201617
Female infertility INFBASE: 26871558
Polycystic ovary syndrome (PCOS) INFBASE: 18218037
Ovarian endometriosis INFBASE: 23025883
Ovarian hyperstimulation syndrome (OHSS) INFBASE: 26823856
Recurrent pregnancy loss (RPL) INFBASE: 12660269
Unexplained infertility INFBASE: 12607776
Unexplained infertility INFBASE: 24368037
Recurrent pregnancy loss (RPL) INFBASE: 22349103
Turners syndrome INFBASE: 22342295
Oligoasthenozoospermia MIK: 19239426
Azoospermia MIK: 10526637
Impaired human spermatogenesis MIK: 19527232
Male factor infertility MIK: 19527232
Sperm autoantibodies MIK: 19239426
Obstructive azoospermia MIK: 19811461
Male subfertility MIK: 19811461
Male factor infertility MIK: 26648778
Oligoasthenozoospermia MIK: 10526637
Prostatitis MIK: 24329571
Prostato-vesiculitis MIK: 24329571
Male factor infertility MIK: 19811461
Asthenozoospermia MIK: 19811461
Chronic obstructive pulmonary disease (COPD) GAD: 15663746
Interstitial lung diseases GAD: 19117745
Lung disease GAD: 18493769
Lung disease GAD: 17331973
Pulmonary fibrosis GAD: 16573560
Severe acute respiratory syndrome GAD: 19258635
Wegener granulomatosis GAD: 11715070
Dermatitis GAD: 16681592
Erythema GAD: 19225544
Familial early onset psoriasis GAD: 12932247
Vitiligo GAD: 21085187
Palmoplanta pustulosis GAD: 17263806
Pemphigus vulgaris GAD: 19470040
Connective tissue diseases GAD: 19527514
Chronic periodontitis GAD: 18725394
Periodontal disease GAD: 17448042
Gingivitis GAD: 16171432
Acidosis GAD: 12078789
Adult respiratory distress syndrome GAD: 16585075
Alpha 1-antitrypsin deficiency GAD: 17690329
Alveolitis GAD: 16722148
Aphthous stomatitis GAD: 14629328
Barrett's esophagus GAD: 18192685
Bronchiolitis GAD: 12451269
Bronchitis GAD: 15686588
Cachexia GAD: 19244371
Lymphocytosis Lymphoproliferative Disorders GAD: 18361934
Respiratory distress syndrome GAD: 17314689
Nephropathy GAD: 16493441
Uterine diseases GAD: 18930197
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Azoospermia MIK: 10526637
Oligoteratoasthenoazoospermia (OTA) MIK: 10526637
Spermatogenic defects MIK: 19527232
Male infertility MIK: 15595690
Prostatitis and prostato-vesiculitis MIK: 24329571
Sperm autoantibodies MIK: 19239426
Oligoasthenozoospermia MIK: 19239426
Asthenozoospermia MIK: 19239426

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
19811461 Male subfe
rtility
74 male partner
s of an inferti
le couple
 Male infertility IL-6
IL-8
IL-10
IL-11
IL-12
 TNF-alpha and IFN-gamma
 Show abstract
26648778 Male infer
tility
82 (27 healthy
controls, 55 in
fertile patient
s (22 patients
with varicocele
, 13 with idiop
athic infertili
ty) )
 Male infertility IL-1?
IL-10
IL-18
TGF-?1
IFN-g
IL-6
 Show abstract
20576636 Infertilit
y
96 (male infert
ility, n = 61;
female infertil
ity factors, n
= 35)
 Male infertility, Female infertility
Show abstract
19811461 Subfertile
men
75 male partner
s
 Male infertility IL-6
IL-10
TNF-alpha
IFN-gamma
 Show abstract
19527232 Impaired h
uman sperm
atogenesis
39 (10 controls
, 29 azoospermi
c patients (9 S
ertoli cell onl
y syndrome, 7 u
ndefined matura
tion arrest, 4
maturation arre
st at a spermat
ocyte stage, 3
maturation arre
st at a spermat
id stage and OA
, 6 obstructive
azospermia )
)
 Male infertility IL-6
IL-10
TNF-alpha
TNFR1 and TNFR2
 Show abstract
12623747 Male infer
tility
70 (45 infertil
e undiagnosed a
nd 25 fertile m
en)
 Male infertility IL-10
IL-6
 Show abstract
10526637 Male infer
tility
80 (21 fertile
men(FERT), 20 m
en with OTA, 18
patients witha
zoospermia (AZO
O) and 21 men w
ith OTA andgeni
tal infection (
OTA-INF))
 Male infertility IL-12
PGE2
sIL-2R and sIL-6R
 Show abstract
24329571 Male infer
tility, pr
ostatitis
and prosta
to-vesicul
itis
211 (169 infert
ile patients (7
4 chronic bacte
rial prostatiti
s, 95 bilateral
prostato-vesic
ulitis), 42 fer
tile men)
 Male infertility TNF-?
IL-6
IL-10
 Show abstract
15595690 Male infer
tility
146 (126 infert
ile males, 20 m
ales)
 Male infertility IL1b
IL4
IL10
 Show abstract
12623747 Male infer
tility
70 (45 infertil
e undiagnosed a
nd 25 fertile m
en)
 Male infertility IL10
IL6
 Show abstract
19811461 Obstructed
azoosperm
ia, asthen
ospermia
73 male partner
s of an inferti
le couple atten
ding a regional
andrology unit
 
 Male infertility  IL-6
IL-8
IL-10
IL-11
IL-12
TNF-alpha and IFN-gamma
 Show abstract
12623747 Male infer
tility
70 (45 infertil
e, 25 fertile m
en )
 Male infertility PGE(2)
IL-10
and IL-6
 Show abstract
19239426 Male infer
tility, Sp
erm autoan
tibodies,
oligoasthe
nospermia,
asthenosp
ermia

Male infertility IL-1beta
IL-2
 IL-4
IL-5
IL-6
IL-8
IL-10
IL-12p70 TNF-alpha
and IFN-gamma
 Show abstract
10526637 Azoospermi
a, oligote
rato-asthe
noazoosper
mia (OTA)

Male infertility IL-12
IL-10
PGE2
sIL-2R and sIL-6R
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract