• Gene id: 3579

Gene Summary

• Gene Symbol: CXCR2   Gene   UCSC   Ensembl
• Aliases: CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB
• Gene name: C-X-C motif chemokine receptor 2
• Alternate names: C-X-C chemokine receptor type 2, CXC-R2, CXCR-2, CXCR2 gene for IL8 receptor type B, GRO/MGSA receptor, IL-8 receptor type 2, IL-8R B, chemokine (CXC) receptor 2, high affinity interleukin-8 receptor B, interleukin 8 receptor type 2, interleukin 8 receptor, beta, in,
• Gene location: 2q35 (218125293: 218137252)     Exons: 6     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system.
• OMIM: 146928

Protein Summary

• Protein general information: P25025  
  • Name: C X C chemokine receptor type 2 (CXC R2) (CXCR 2) (CDw128b) (GRO/MGSA receptor) (High affinity interleukin 8 receptor B) (IL 8R B) (IL 8 receptor type 2) (CD antigen CD182)
  • Length: 360  
  • Mass: 40759
• Sequence:

  MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVMLVILY
  SRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVH
  ATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLL
  IMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
  ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

• Structural information:
  • Interpro: IPR000057  IPR000174  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 4Q3H 5TYT
  • PDBsum: 4Q3H 5TYT
  • DIP: 3782
  • STRING: ENSP00000319635
• Other Databases: GeneCards:  CXCR2  Malacards:  CXCR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0019959	interleukin-8 binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043117	positive regulation of vascular permeability	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0010666	positive regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0002690	positive regulation of leukocyte chemotaxis	IEA	biological process
GO:0002438	acute inflammatory response to antigenic stimulus	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0072173	metanephric tubule morphogenesis	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0033030	negative regulation of neutrophil apoptotic process	IEA	biological process
GO:0030901	midbrain development	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0038112	interleukin-8-mediated signaling pathway	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0006968	cellular defense response	IDA	biological process
GO:0004918	interleukin-8 receptor activity	IDA	molecular function
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0042629	mast cell granule	IDA	cellular component
GO:0042119	neutrophil activation	IDA	biological process
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:0016494	C-X-C chemokine receptor activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0019959	interleukin-8 binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04060	Cytokine-cytokine receptor interaction
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa05120	Epithelial cell signaling in Helicobacter pylori infection

Diseases

Associated diseases	References
urinary bladder cancer	PMID:19252927
nephroblastoma	PMID:17634442
Chronic obstructive pulmonary disease	PMID:12857718
Acute pyelonephritis	PMID:22325052
Systemic lupus erythematosus	PMID:14596426
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881