• Gene id: 3577

Gene Summary

• Gene Symbol: CXCR1   Gene   UCSC   Ensembl
• Aliases: C-C, C-C-CKR-1, CD128, CD181, CDw128a, CKR-1, CMKAR1, IL8R1, IL8RA, IL8RBA
• Gene name: C-X-C motif chemokine receptor 1
• Alternate names: C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, IL-8 receptor type 1, IL-8R A, chemokine (C-X-C motif) receptor 1, high affinity interleukin-8 receptor A, interleukin 8 receptor, alpha, interleukin-8 receptor type 1, interleukin-8 receptor type A,
• Gene location: 2q35 (218166961: 218162840)     Exons: 2     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system.
• OMIM: 604024

Protein Summary

• Protein general information: P25024  
  • Name: C X C chemokine receptor type 1 (CXC R1) (CXCR 1) (CDw128a) (High affinity interleukin 8 receptor A) (IL 8R A) (IL 8 receptor type 1) (CD antigen CD181)
  • Length: 350  
  • Mass: 39791
• Sequence:

  MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTD
  VYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKR
  HLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFT
  LRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
  NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

• Structural information:
  • Interpro: IPR001355  IPR000174  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 1ILP 1ILQ 2LNL
  • PDBsum: 1ILP 1ILQ 2LNL
  • DIP: 3779
  • STRING: ENSP00000295683
• Other Databases: GeneCards:  CXCR1  Malacards:  CXCR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0019959	interleukin-8 binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0038112	interleukin-8-mediated signaling pathway	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:0004918	interleukin-8 receptor activity	IDA	molecular function
GO:0019959	interleukin-8 binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa05120	Epithelial cell signaling in Helicobacter pylori infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray