• Gene id: 3574

Gene Summary

• Gene Symbol: IL7   Gene   UCSC   Ensembl
• Aliases: IL-7
• Gene name: interleukin 7
• Alternate names: interleukin-7,
• Gene location: 8q21.13 (78806829: 78675869)     Exons: 8     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cof
• OMIM: 146660

Protein Summary

• Protein general information: P13232  
  • Name: Interleukin 7 (IL 7)
  • Length: 177  
  • Mass: 20187
• Sequence:

  MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDAN
  KEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKL
  NDLCFLKRLLQEIKTCWNKILMGTKEH

• Structural information:
  • Interpro: IPR001181  IPR018049  IPR038325  
  • Prosite: PS00255
  • PDB: 1IL7 3DI2 3DI3
  • PDBsum: 1IL7 3DI2 3DI3
  • DIP: 3044
  • STRING: ENSP00000263851
• Other Databases: GeneCards:  IL7  Malacards:  IL7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005126	cytokine receptor binding	IEA	molecular function
GO:0005139	interleukin-7 receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005139	interleukin-7 receptor binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0006959	humoral immune response	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0038111	interleukin-7-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0002360	T cell lineage commitment	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0010468	regulation of gene expression	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0045453	bone resorption	IEA	biological process
GO:0045579	positive regulation of B cell differentiation	IEA	biological process
GO:0046622	positive regulation of organ growth	IEA	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IDA	biological process
GO:0045453	bone resorption	ISS	biological process
GO:0045582	positive regulation of T cell differentiation	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0030890	positive regulation of B cell proliferation	ISS	biological process
GO:0008083	growth factor activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Alzheimer's disease	PMID:22571981
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R