• Gene id: 3572

Gene Summary

• Gene Symbol: IL6ST   Gene   UCSC   Ensembl
• Aliases: CD130, CDW130, GP130, IL-6RB
• Gene name: interleukin 6 signal transducer
• Alternate names: interleukin-6 receptor subunit beta, CD130 antigen, IL-6 receptor subunit beta, IL-6R subunit beta, gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form, gp130, oncostatin M receptor, interleukin receptor beta chain, membrane glycoprot,
• Gene location: 5q11.2 (55994992: 55935094)     Exons: 19     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine
• OMIM: 600694

Protein Summary

• Protein general information: P40189  
  • Name: Interleukin 6 receptor subunit beta (IL 6 receptor subunit beta) (IL 6R subunit beta) (IL 6R beta) (IL 6RB) (CDw130) (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin M receptor subunit alpha) (CD antigen CD130)
  • Length: 918  
  • Mass: 103,537
  • Tissue specificity: Predominantly expressed in skeletal muscle and kidney. Also found in brain, heart, colon, testis and prostate. {ECO
• Sequence:

  MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIP
  KEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDGGR
  ETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPP
  HNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
  CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKS
  HLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESV
  KKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTV
  RTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
  KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHN
  FNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESS
  QNTSSTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESS
  PDISHFERSKQVSSVNEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
  MPKSYLPQTVRQGGYMPQ

• Structural information:
  • Protein Domains: Ig-like (26-120)
    Fibronectin (125-216)
    Fibronectin (224-324)
    Fibronectin (329-424)
  • Interpro: IPR003961  IPR036116  IPR003529  IPR013783  IPR010457   IPR015321  
  • Prosite: PS50853 PS01353
  • CDD: cd00063
  • PDB: 1BJ8 1BQU 1I1R 1N2Q 1P9M 1PVH 3L5H 3L5I 3L5J
  • PDBsum: 1BJ8 1BQU 1I1R 1N2Q 1P9M 1PVH 3L5H 3L5I 3L5J
  • DIP: 95
  • STRING: ENSP00000338799
• Other Databases: GeneCards:  IL6ST  Malacards:  IL6ST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002675	positive regulation of acute inflammatory response	IC	biological process
GO:0002821	positive regulation of adaptive immune response	IC	biological process
GO:0004897	ciliary neurotrophic factor receptor activity	IDA	molecular function
GO:0004921	interleukin-11 receptor activity	IEA	molecular function
GO:0005127	ciliary neurotrophic factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005900	oncostatin-M receptor complex	IDA	cellular component
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IGI	biological process
GO:0008593	regulation of Notch signaling pathway	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0010575	positive regulation of vascular endothelial growth factor production	TAS	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0019970	interleukin-11 binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0034097	response to cytokine	IDA	biological process
GO:0034097	response to cytokine	IDA	biological process
GO:0038154	interleukin-11-mediated signaling pathway	IEA	biological process
GO:0038165	oncostatin-M-mediated signaling pathway	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	IMP	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IMP	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IMP	biological process
GO:0042803	protein homodimerization activity	TAS	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0045509	interleukin-27 receptor activity	IC	molecular function
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070104	negative regulation of interleukin-6-mediated signaling pathway	IDA	biological process
GO:0070106	interleukin-27-mediated signaling pathway	IMP	biological process
GO:0070110	ciliary neurotrophic factor receptor complex	IDA	cellular component
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IDA	biological process
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0004923	leukemia inhibitory factor receptor activity	IDA	molecular function
GO:0004923	leukemia inhibitory factor receptor activity	IDA	molecular function
GO:0004924	oncostatin-M receptor activity	IDA	molecular function
GO:0005138	interleukin-6 receptor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019981	interleukin-6 binding	IPI	molecular function
GO:0002675	positive regulation of acute inflammatory response	IC	biological process
GO:0002821	positive regulation of adaptive immune response	IC	biological process
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0004897	ciliary neurotrophic factor receptor activity	IDA	molecular function
GO:0004921	interleukin-11 receptor activity	IEA	molecular function
GO:0005127	ciliary neurotrophic factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005900	oncostatin-M receptor complex	IDA	cellular component
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IGI	biological process
GO:0008593	regulation of Notch signaling pathway	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0010575	positive regulation of vascular endothelial growth factor production	TAS	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0019970	interleukin-11 binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0034097	response to cytokine	IDA	biological process
GO:0034097	response to cytokine	IDA	biological process
GO:0038154	interleukin-11-mediated signaling pathway	IEA	biological process
GO:0038165	oncostatin-M-mediated signaling pathway	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	IMP	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IMP	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IMP	biological process
GO:0042803	protein homodimerization activity	TAS	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0044297	cell body	IEA	cellular component
GO:0045509	interleukin-27 receptor activity	IC	molecular function
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070104	negative regulation of interleukin-6-mediated signaling pathway	IDA	biological process
GO:0070106	interleukin-27-mediated signaling pathway	IMP	biological process
GO:0070110	ciliary neurotrophic factor receptor complex	IDA	cellular component
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IDA	biological process
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0004923	leukemia inhibitory factor receptor activity	IDA	molecular function
GO:0004923	leukemia inhibitory factor receptor activity	IDA	molecular function
GO:0004924	oncostatin-M receptor activity	IDA	molecular function
GO:0005138	interleukin-6 receptor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019981	interleukin-6 binding	IPI	molecular function
GO:0002675	positive regulation of acute inflammatory response	IC	biological process
GO:0002821	positive regulation of adaptive immune response	IC	biological process
GO:0004897	ciliary neurotrophic factor receptor activity	IDA	molecular function
GO:0005127	ciliary neurotrophic factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005900	oncostatin-M receptor complex	IDA	cellular component
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IGI	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	TAS	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0034097	response to cytokine	IDA	biological process
GO:0034097	response to cytokine	IDA	biological process
GO:0038165	oncostatin-M-mediated signaling pathway	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	IMP	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IMP	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IMP	biological process
GO:0042803	protein homodimerization activity	TAS	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0045509	interleukin-27 receptor activity	IC	molecular function
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070104	negative regulation of interleukin-6-mediated signaling pathway	IDA	biological process
GO:0070106	interleukin-27-mediated signaling pathway	IMP	biological process
GO:0070110	ciliary neurotrophic factor receptor complex	IDA	cellular component
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IDA	biological process
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0004923	leukemia inhibitory factor receptor activity	IDA	molecular function
GO:0004923	leukemia inhibitory factor receptor activity	IDA	molecular function
GO:0004924	oncostatin-M receptor activity	IDA	molecular function
GO:0005138	interleukin-6 receptor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019981	interleukin-6 binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04659	Th17 cell differentiation
hsa05200	Pathways in cancer
hsa05203	Viral carcinogenesis
hsa05167	Kaposi sarcoma-associated herpesvirus infection

Diseases

Associated diseases	References
Cancer	GAD: 19124510
Cancer (leukemia)	GAD: 19074885
Cancer (ovarian)	GAD: 20628624
Cancer (thyroid)	GAD: 19730683
Cancer (myeloma)	GAD: 19124510
Cardiovascular disease	GAD: 17997171
Coronary heart disease	GAD: 19336475
Hodgkin disease	GAD: 19573080
Arthritis	GAD: 20453842
Celiac disease	GAD: 19240061
Metabolic syndrome	GAD: 18223637
Obesity	GAD: 12917504
Bone diseases	GAD: 19453261
Endometriosis	INFBASE: 25631342
Primary unexplained infertility	INFBASE: 12161539
Primary unexplained infertility	INFBASE: 12161539
Polycystic ovary syndrome (PCOS)	INFBASE: 20103703
Unexplained infertility	INFBASE: 18684446
Asthenozoospermia	MIK: 16728717
Asthenozoospermia	MIK: 20369545
Male factor infertility	MIK: 16728717
Male factor infertility	MIK: 20231113
Endometriosis	INFBASE: 18353903
Female infertility	INFBASE: 18353903
Female infertility	INFBASE: 12161539
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 16728717
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16728717	Asthenozoospermia				Male infertility	IL-6 GP130
20369545	Asthenozoospermia			6 seminal plasma samples were collected by Percoll respectively from healthy fertile and asthenozoospermia volunteers	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
20231113	Asthenozoospermia			12 (6 healthy fertile men, 6 asthenozoospermia volunteers)	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray