• Gene id: 3570

Gene Summary

• Gene Symbol: IL6R   Gene   UCSC   Ensembl
• Aliases: CD126, IL-6R-1, IL-6RA, IL6Q, IL6RA, IL6RQ, gp80
• Gene name: interleukin 6 receptor
• Alternate names: interleukin-6 receptor subunit alpha, CD126 antigen, IL-6 receptor subunit alpha, IL-6R 1, membrane glycoprotein 80,
• Gene location: 1q21.3 (154405192: 154469449)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein comple
• OMIM: 147880

Protein Summary

• Protein general information: P08887  
  • Name: Interleukin 6 receptor subunit alpha (IL 6 receptor subunit alpha) (IL 6R subunit alpha) (IL 6R alpha) (IL 6RA) (IL 6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126)
  • Length: 468  
  • Mass: 51,548
• Sequence:

  MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWA
  GMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
  RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVT
  AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLA
  FGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
  RDPRSPYDISNTDYFFPR

• Structural information:
  • Protein Domains: Ig-like (26-112)
    Fibronectin (113-217)
    Fibronectin (218-316)
  • Interpro: IPR003961  IPR036116  IPR003530  IPR007110  IPR036179   IPR013783  IPR003599  IPR003598  IPR013151  IPR015321  
  • Prosite: PS50853 PS01354 PS50835
  • CDD: cd00063
  • PDB: 1N26 1N2Q 1P9M 2ARW 5FUC
  • PDBsum: 1N26 1N2Q 1P9M 2ARW 5FUC
  • DIP: 162
  • STRING: ENSP00000357470
• Other Databases: GeneCards:  IL6R  Malacards:  IL6R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002384	hepatic immune response	TAS	biological process
GO:0002446	neutrophil mediated immunity	TAS	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0002690	positive regulation of leukocyte chemotaxis	TAS	biological process
GO:0002690	positive regulation of leukocyte chemotaxis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0006953	acute-phase response	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0010536	positive regulation of activation of Janus kinase activity	IDA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019981	interleukin-6 binding	IPI	molecular function
GO:0031018	endocrine pancreas development	IC	biological process
GO:0031018	endocrine pancreas development	IMP	biological process
GO:0032717	negative regulation of interleukin-8 production	NAS	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032966	negative regulation of collagen biosynthetic process	IDA	biological process
GO:0034097	response to cytokine	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	TAS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	TAS	biological process
GO:0050830	defense response to Gram-positive bacterium	NAS	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070110	ciliary neurotrophic factor receptor complex	IDA	cellular component
GO:0070119	ciliary neurotrophic factor binding	IPI	molecular function
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0004897	ciliary neurotrophic factor receptor activity	IMP	molecular function
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0005138	interleukin-6 receptor binding	IPI	molecular function
GO:0002384	hepatic immune response	TAS	biological process
GO:0002446	neutrophil mediated immunity	TAS	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0002690	positive regulation of leukocyte chemotaxis	TAS	biological process
GO:0002690	positive regulation of leukocyte chemotaxis	TAS	biological process
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0004915	interleukin-6 receptor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0006953	acute-phase response	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0010536	positive regulation of activation of Janus kinase activity	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019981	interleukin-6 binding	IEA	molecular function
GO:0019981	interleukin-6 binding	IPI	molecular function
GO:0031018	endocrine pancreas development	IC	biological process
GO:0031018	endocrine pancreas development	IMP	biological process
GO:0032717	negative regulation of interleukin-8 production	NAS	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032966	negative regulation of collagen biosynthetic process	IDA	biological process
GO:0034097	response to cytokine	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	TAS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	TAS	biological process
GO:0050830	defense response to Gram-positive bacterium	NAS	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IEA	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070110	ciliary neurotrophic factor receptor complex	IDA	cellular component
GO:0070119	ciliary neurotrophic factor binding	IPI	molecular function
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0004897	ciliary neurotrophic factor receptor activity	IMP	molecular function
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0005138	interleukin-6 receptor binding	IPI	molecular function
GO:0002384	hepatic immune response	TAS	biological process
GO:0002446	neutrophil mediated immunity	TAS	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0002690	positive regulation of leukocyte chemotaxis	TAS	biological process
GO:0002690	positive regulation of leukocyte chemotaxis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0005896	interleukin-6 receptor complex	IDA	cellular component
GO:0006953	acute-phase response	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0010536	positive regulation of activation of Janus kinase activity	IDA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019981	interleukin-6 binding	IPI	molecular function
GO:0031018	endocrine pancreas development	IC	biological process
GO:0031018	endocrine pancreas development	IMP	biological process
GO:0032717	negative regulation of interleukin-8 production	NAS	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032966	negative regulation of collagen biosynthetic process	IDA	biological process
GO:0034097	response to cytokine	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	TAS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	TAS	biological process
GO:0050830	defense response to Gram-positive bacterium	NAS	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070110	ciliary neurotrophic factor receptor complex	IDA	cellular component
GO:0070119	ciliary neurotrophic factor binding	IPI	molecular function
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0004897	ciliary neurotrophic factor receptor activity	IMP	molecular function
GO:0004915	interleukin-6 receptor activity	IDA	molecular function
GO:0005138	interleukin-6 receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04066	HIF-1 signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04640	Hematopoietic cell lineage
hsa04659	Th17 cell differentiation
hsa05200	Pathways in cancer
hsa04932	Non-alcoholic fatty liver disease
hsa05163	Human cytomegalovirus infection
hsa01521	EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Cancer	GAD: 19773451
Cancer (bladder)	GAD: 19692168
Cancer (esophageal)	GAD: 19801321
Cancer (lung)	GAD: 18676680
Cancer (melanoma)	GAD: 18781131
Cancer (myeloma)	GAD: 19124510
Cancer (Squamous cell)	GAD: 19495883
Cardiovascular disease	GAD: 22319020
Coronary heart disease	GAD: 19336475
Hodgkin disease	GAD: 19573080
Asthma	GAD: 19503017
Behcet's disease	GAD: 19026125
Celiac disease	GAD: 19480857
Rheumatoid arthritis	GAD: 19926672
Periodontitis	GAD: 16899024
Arthritis	GAD: 20551110
Metabolic syndrome	GAD: 16817825
Obesity	GAD: 12917504
Diabetes	GAD: 15561970
Bone diseases	GAD: 19453261
Alzheimer's disease	GAD: 19141999
Schizophrenia	GAD: 19914334
Chronic renal failure	GAD: 21085059
Chorioamnionitis	GAD: 20452482
Premature birth	GAD: 18538149
Preterm birth risk	GAD: 16731080
Primary unexplained infertility	INFBASE: 12161539
Female infertility	INFBASE: 10579621
Polycystic ovary syndrome (PCOS)	INFBASE: 24423322
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 10579621
Asthenozoospermia	MIK: 16728717
Male factor infertility	MIK: 16728717
Spermatogenesis defects	MIK: 15166129
Male factor infertility	MIK: 9262280
Male factor infertility	MIK: 9262280
Endometriosis-associated infertility	INFBASE: 15166129
Pulmonary function	GAD: 17903307
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Connective tissue diseases	GAD: 19527514
Asthenozoospermia	MIK: 16728717
Male infertility	MIK: 9262280
Endometriosis-associated infertility	MIK: 15166129
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16728717	Asthenozoospermia				Male infertility	IL-6 GP130
15166129	Reduced sperm motility, endometriosis-associated infertility			20	Male infertility
9262280	Male infertility			140 (21 fertile subjects, 119 patients with a range of andrological diseases)	Male infertility	IL-beta IL-2 IL-6 sR IL-2 SR IL-6
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R