• Gene id: 3568

Gene Summary

• Gene Symbol: IL5RA   Gene   UCSC   Ensembl
• Aliases: CD125, CDw125, HSIL5R3, IL5R
• Gene name: interleukin 5 receptor subunit alpha
• Alternate names: interleukin-5 receptor subunit alpha, CD125 antigen, IL-5 receptor subunit alpha, IL-5R subunit alpha, interleukin 5 receptor type 3, interleukin 5 receptor, alpha, interleukin-5 receptor alpha chain,
• Gene location: 3p26.2 (3110413: 3066323)     Exons: 15     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3),
• OMIM: 603771

Protein Summary

• Protein general information: Q01344  
  • Name: Interleukin 5 receptor subunit alpha (IL 5 receptor subunit alpha) (IL 5R subunit alpha) (IL 5R alpha) (IL 5RA) (CDw125) (CD antigen CD125)
  • Length: 420  
  • Mass: 47685
  • Tissue specificity: Expressed on eosinophils and basophils.
• Sequence:

  MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKED
  DYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQ
  VSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIR
  PFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
  LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSLICKICHLWIKLFPPI
  PAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF

• Structural information:
  • Protein Domains: (32..12-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (241..33-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR003532  IPR015321  
  • Prosite: PS50853 PS01356
  • PDB: 1OBX 1OBZ 3QT2 3VA2 6H41
  • PDBsum: 1OBX 1OBZ 3QT2 3VA2 6H41
  • DIP: 3510
  • STRING: ENSP00000412209
• Other Databases: GeneCards:  IL5RA  Malacards:  IL5RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019955	cytokine binding	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004914	interleukin-5 receptor activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological process
GO:0032674	regulation of interleukin-5 production	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0070665	positive regulation of leukocyte proliferation	TAS	biological process
GO:0038043	interleukin-5-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Asthma	PMID:10224351
Asthma	PMID:20513521
Chronic obstructive pulmonary disease	PMID:15286446
Mastocytosis	PMID:21762978
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray