• Gene id: 3567

Gene Summary

• Gene Symbol: IL5   Gene   UCSC   Ensembl
• Aliases: EDF, IL-5, TRF
• Gene name: interleukin 5
• Alternate names: interleukin-5, B-cell differentiation factor I, T-cell replacing factor, colony-stimulating factor, eosinophil, eosinophil differentiation factor,
• Gene location: 5q31.1 (132556863: 132539193)     Exons: 6     NC_000005.10
• Gene summary(Entrez): This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation, recruitment and survival. The increased producti
• OMIM: 147850

Protein Summary

• Protein general information: P05113  
  • Name: Interleukin 5 (IL 5) (B cell differentiation factor I) (Eosinophil differentiation factor) (T cell replacing factor) (TRF)
  • Length: 134  
  • Mass: 15,238
• Sequence:

  MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLE
  SQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES

• Structural information:
  • Interpro: IPR009079  IPR000186  
  • PDB: 1HUL 3QT2 3VA2
  • PDBsum: 1HUL 3QT2 3VA2
  • DIP: 28
  • STRING: ENSP00000231454
• Other Databases: GeneCards:  IL5  Malacards:  IL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005125	cytokine activity	IBA	molecular function
GO:0005137	interleukin-5 receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030890	positive regulation of B cell proliferation	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045645	positive regulation of eosinophil differentiation	IEA	biological process
GO:0046427	positive regulation of JAK-STAT cascade	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IBA	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IEA	biological process
GO:0071803	positive regulation of podosome assembly	IDA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005137	interleukin-5 receptor binding	IEA	molecular function
GO:0005137	interleukin-5 receptor binding	IEA	molecular function
GO:0005137	interleukin-5 receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045645	positive regulation of eosinophil differentiation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0046427	positive regulation of JAK-STAT cascade	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IEA	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IBA	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IEA	biological process
GO:0071803	positive regulation of podosome assembly	IDA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005125	cytokine activity	IBA	molecular function
GO:0005137	interleukin-5 receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030890	positive regulation of B cell proliferation	IBA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IBA	biological process
GO:0071803	positive regulation of podosome assembly	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04640	Hematopoietic cell lineage
hsa04660	T cell receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04657	IL-17 signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa04672	Intestinal immune network for IgA production
hsa05200	Pathways in cancer
hsa05310	Asthma
hsa05320	Autoimmune thyroid disease
hsa05321	Inflammatory bowel disease
hsa05330	Allograft rejection

Diseases

Associated diseases	References
Cancer (Biliary tract neoplasms)	GAD: 18676870
Cancer (esophageal)	GAD: 20453000
Cancer (lung)	GAD: 19773451
Cancer (lymphoma)	GAD: 18633131
Cancer (myeloma)	GAD: 20568250
Cancer (non-Hodgkin lymphoma)	GAD: 16449530
Cancer (prostate)	GAD: 20403914
Cancer (breast)	GAD: 20418110
Cancer	GAD: 19773451
Hypertension	GAD: 19578876
Eosinophilia	GAD: 9758611
Hodgkin disease	GAD: 19573080
Asthma	GAD: 15805995
Celiac disease	GAD: 15713213
Multiple sclerosis	GAD: 18563468
Systemic lupus erythematosus (SLE)	GAD: 20530519
Atopy	GAD: 15007355
Inflammatory bowel disease	GAD: 15842590
Schizophrenia	GAD: 19914334
Chronic renal failure	GAD: 21085059
Chorioamnionitis	GAD: 20452482
Preeclampsia	GAD: 19578876
Female infertility	INFBASE: 7904954
Oligoasthenozoospermia	MIK: 19239426
Sperm autoantibodies	MIK: 19239426
Male factor infertility	MIK: 19239426
Asthenozoospermia	MIK: 19239426
Endometriosis	INFBASE: 9436700
Nasal polyposis	GAD: 19860791
Rhinitis	GAD: 19222422
Dermatitis	GAD: 14581138
Connective tissue diseases	GAD: 19527514
Male infertility	MIK: 19239426
Sperm autoantibodies	MIK: 19239426
Oligoasthenozoospermia	MIK: 19239426
Asthenozoospermia	MIK: 19239426

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19239426	Male infertility, Sperm autoantibodies, oligoasthenospermia, asthenospermia				Male infertility	IL-1beta IL-2  IL-4 IL-5 IL-6 IL-8 IL-10 IL-12p70 TNF-alpha and IFN-gamma