• Gene id: 3562

Gene Summary

• Gene Symbol: IL3   Gene   UCSC   Ensembl
• Aliases: IL-3, MCGF, MULTI-CSF
• Gene name: interleukin 3
• Alternate names: interleukin-3, P-cell stimulating factor, colony-stimulating factor, multiple, hematopoietic growth factor, mast-cell growth factor, multilineage-colony-stimulating factor, multipotential colony-stimulating factor,
• Gene location: 5q31.1 (132060654: 132063203)     Exons: 5     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiat
• OMIM: 147740

Protein Summary

• Protein general information: P08700  
  • Name: Interleukin 3 (IL 3) (Hematopoietic growth factor) (Mast cell growth factor) (MCGF) (Multipotential colony stimulating factor) (P cell stimulating factor)
  • Length: 152  
  • Mass: 17233
  • Tissue specificity: Activated T-cells, mast cells, natural killer cells.
• Sequence:

  MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRP
  NLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLA
  IF

• Structural information:
  • Interpro: IPR009079  IPR002183  
  • PDB: 1JLI 5UV8 5UWC 6NMY
  • PDBsum: 1JLI 5UV8 5UWC 6NMY
  • DIP: 6
  • STRING: ENSP00000296870
• Other Databases: GeneCards:  IL3  Malacards:  IL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035162	embryonic hemopoiesis	IDA	biological process
GO:0005135	interleukin-3 receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0007399	nervous system development	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0001959	regulation of cytokine-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0005135	interleukin-3 receptor binding	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa05202	Transcriptional misregulation in cancer
hsa04630	JAK-STAT signaling pathway
hsa04210	Apoptosis
hsa04640	Hematopoietic cell lineage
hsa04664	Fc epsilon RI signaling pathway
hsa05221	Acute myeloid leukemia
hsa05310	Asthma

Diseases

Associated diseases	References
Alzheimer's disease	PMID:18769539
Graves' disease	PMID:20332709
Major depressive disorder	PMID:20479761
pancreatic cancer	PMID:15843207
Asthma	PMID:24684517
Rheumatoid arthritis	PMID:20018070
Psoriasis	PMID:19889595
obesity	PMID:21203453
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray