• Gene id: 3560

Gene Summary

• Gene Symbol: IL2RB   Gene   UCSC   Ensembl
• Aliases: CD122, IL15RB, IMD63, P70-75
• Gene name: interleukin 2 receptor subunit beta
• Alternate names: interleukin-2 receptor subunit beta, CD122 antigen, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, high affinity IL-2 receptor beta subunit, high affinity IL-2 receptor subunit beta, interleukin 15 receptor, beta, interleukin 2 receptor, beta, interleukin,
• Gene location: 22q12.3 (37175117: 37125837)     Exons: 11     NC_000022.11
• Gene summary(Entrez): The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The
• OMIM: 617586

Protein Summary

• Protein general information: P14784  
  • Name: Interleukin 2 receptor subunit beta (IL 2 receptor subunit beta) (IL 2R subunit beta) (IL 2RB) (High affinity IL 2 receptor subunit beta) (Interleukin 15 receptor subunit beta) (p70 75) (p75) (CD antigen CD122)
  • Length: 551  
  • Mass: 61117
• Sequence:

  MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCE
  LLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNI
  SWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQ
  PLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
  QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEI
  EACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGA
  GEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRAL
  NARLPLNTDAYLSLQELQGQDPTHLV

• Structural information:
  • Protein Domains: (134..23-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR003531  IPR013783  IPR040951  
  • Prosite: PS50853 PS01355
  • CDD: cd00063
  • PDB: 1ILM 1ILN 2B5I 2ERJ 3QAZ 4GS7 5M5E 6E8K
  • PDBsum: 1ILM 1ILN 2B5I 2ERJ 3QAZ 4GS7 5M5E 6E8K
  • DIP: 43
  • STRING: ENSP00000216223
• Other Databases: GeneCards:  IL2RB  Malacards:  IL2RB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038110	interleukin-2-mediated signaling pathway	IMP	biological process
GO:0004911	interleukin-2 receptor activity	IMP	molecular function
GO:0004911	interleukin-2 receptor activity	IMP	molecular function
GO:0009986	cell surface	IMP	cellular component
GO:0009986	cell surface	IMP	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0019976	interleukin-2 binding	IMP	molecular function
GO:0035723	interleukin-15-mediated signaling pathway	IMP	biological process
GO:0019976	interleukin-2 binding	IMP	molecular function
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0004911	interleukin-2 receptor activity	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035723	interleukin-15-mediated signaling pathway	TAS	biological process
GO:0005768	endosome	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038110	interleukin-2-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019976	interleukin-2 binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042010	interleukin-15 receptor activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0035723	interleukin-15-mediated signaling pathway	IMP	biological process
GO:0019976	interleukin-2 binding	IMP	molecular function
GO:0005893	interleukin-2 receptor complex	TAS	cellular component
GO:0004911	interleukin-2 receptor activity	IMP	contributes to
GO:0019976	interleukin-2 binding	ISS	molecular function
GO:0009897	external side of plasma membrane	ISS	cellular component
GO:0038110	interleukin-2-mediated signaling pathway	TAS	biological process
GO:0050766	positive regulation of phagocytosis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04144	Endocytosis
hsa04060	Cytokine-cytokine receptor interaction
hsa05166	Human T-cell leukemia virus 1 infection
hsa05202	Transcriptional misregulation in cancer
hsa04630	JAK-STAT signaling pathway
hsa05162	Measles
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04659	Th17 cell differentiation
hsa04658	Th1 and Th2 cell differentiation

Diseases

Associated diseases	References
Asthma	PMID:20860503
Myasthenia gravis	PMID:20728947
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq