• Gene id: 356

Gene Summary

• Gene Symbol: FASLG   Gene   UCSC   Ensembl
• Aliases: ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A
• Gene name: Fas ligand
• Alternate names: tumor necrosis factor ligand superfamily member 6, CD95 ligand, Fas ligand (TNF superfamily, member 6), apoptosis (APO-1) antigen ligand 1, apoptosis antigen ligand, fas antigen ligand, mutant tumor necrosis factor family member 6, tumor necrosis factor l,
• Gene location: 1q24.3 (172659007: 172666872)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation,
• OMIM: 134638

SNPs

rs763110

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.172658358C>T
NC_000001.10   g.172627498C>T
NG_007269.1   g.4314C>T|SEQ=[C/T]|GENE=FASLG

rs6313

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000013.11   g.46895805G>A
NC_000013.11   g.46895805G>C
NC_000013.10   g.47469940G>A
NC_000013.10   g.47469940G>C
NG_013011.1   g.6230C>T
NG_013011.1   g.6230C>G
NM_000621.5   c.102C>T
NM_000621.5   c.102C>G
NM_000621.4   c.102C>T
NM_000621.4   c.102C>G
NM_001378924.1  

Protein Summary

• Protein general information: P48023  
  • Name: Tumor necrosis factor ligand superfamily member 6 (Apoptosis antigen ligand) (APTL) (CD95 ligand) (CD95 L) (Fas antigen ligand) (Fas ligand) (FasL) (CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor n
  • Length: 281  
  • Mass: 31,485
• Sequence:

  MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRG
  NHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLT
  GKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMM
  EGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

• Structural information:
  • Interpro: IPR028326  IPR006053  IPR021184  IPR006052  IPR008983  
  • Prosite: PS00251 PS50049
  • PDB: 1BZI 4MSV 5L19 5L36
  • PDBsum: 1BZI 4MSV 5L19 5L36
  • DIP: 2997
  • STRING: ENSP00000356694
• Other Databases: GeneCards:  FASLG  Malacards:  FASLG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0005102	receptor binding	TAS	molecular function
GO:0005123	death receptor binding	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IGI	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006925	inflammatory cell apoptotic process	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0030644	cellular chloride ion homeostasis	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0046666	retinal cell programmed cell death	IEA	biological process
GO:0048388	endosomal lumen acidification	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0060205	cytoplasmic vesicle lumen	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070231	T cell apoptotic process	IDA	biological process
GO:0070266	necroptotic process	IDA	biological process
GO:0070848	response to growth factor	IEA	biological process
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097527	necroptotic signaling pathway	IDA	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0005102	receptor binding	TAS	molecular function
GO:0005123	death receptor binding	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IGI	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006925	inflammatory cell apoptotic process	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0030644	cellular chloride ion homeostasis	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0046666	retinal cell programmed cell death	IEA	biological process
GO:0048388	endosomal lumen acidification	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0060205	cytoplasmic vesicle lumen	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070231	T cell apoptotic process	IDA	biological process
GO:0070266	necroptotic process	IDA	biological process
GO:0070848	response to growth factor	IEA	biological process
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097527	necroptotic signaling pathway	IDA	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0005102	receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IGI	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070231	T cell apoptotic process	IDA	biological process
GO:0070266	necroptotic process	IDA	biological process
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097527	necroptotic signaling pathway	IDA	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04068	FoxO signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04210	Apoptosis
hsa04217	Necroptosis
hsa04650	Natural killer cell mediated cytotoxicity
hsa04722	Neurotrophin signaling pathway
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer
hsa05320	Autoimmune thyroid disease
hsa05330	Allograft rejection
hsa05332	Graft-versus-host disease
hsa04940	Type I diabetes mellitus
hsa04932	Non-alcoholic fatty liver disease
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05165	Human papillomavirus infection
hsa05142	Chagas disease
hsa05143	African trypanosomiasis
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 16313826
Cancer (esophageal)	GAD: 15240787
Cancer (head and neck)	GAD: 17000697
Cancer (Hepatocellular)	GAD: 17938571
Cancer (leukemia)	GAD: 20959405
Cancer (lung)	GAD: 15937082
Cancer (melanoma)	GAD: 16538172
Cancer (myeloma)	GAD: 20568250
Cancer (nasopharyngeal)	GAD: 20842669
Cancer (ovarian)	GAD: 17465232
Cancer (lung)	GAD: 134638
Cancer	GAD: 16186185
Cancer (Adenocarcinoma)	GAD: 19052714
Cancer (basal cell)	GAD: 20219325
Cancer (bladder)	GAD: 16538171
Cancer (cervical)	GAD: 16186185
Cancer (Renal cell)	GAD: 20572163
Cancer (Squamous cell)	GAD: 20359312
Cancer (stomach)	GAD: 19565204
Cancer (thyroid)	GAD: 17598974
Cancer (Waldenstrom macroglobulinaemia)	GAD: 19573080
Cancer (breast)	GAD: 17183065
Graves disease	GAD: 12559631
Thrombocytopenia	GAD: 16163374
Sjogren's syndrome	GAD: 11036836
Multiple sclerosis	GAD: 15218339
Systemic lupus erythematosus (SLE)	GAD: 18069935
Systemic lupus erythematosus (SLE)	GAD: 10643709
Autoimmune diseases	KEGG: H00108, GAD: 134638
Celiac disease	GAD: 20190752
Celiac disease	GAD: 20190752
Crohn's disease	GAD: 16181301
Diabetes	GAD: 11845233
Hypercholesterolemia	GAD: 20602615
Alzheimer's disease	GAD: 14739535
Azoospermia	GAD: 17491259
Oligozoospermia	GAD: 17491259
Preeclampsia	GAD: 19926197
Endometriosis	INFBASE: 12372468
Female infertility	INFBASE: 15104227
Placenta diseases	INFBASE: 21501125
Polycystic ovary syndrome (PCOS)	INFBASE: 15932917
Recurrent pregnancy loss (RPL)	INFBASE: 23218678
Abnormal seminal plasma	MIK: 23422491
Abnormal sperm	MIK: 15979995
Male factor infertility	MIK: 23422491
Male factor infertility	MIK: 10946867
Azoospermia or severe oligozoospermia	MIK: 19146781
Semen analysis	MIK: 23422491
Male factor infertility	MIK: 23422491
Maturation arrest	MIK: 17123522
Sertoli cell only syndrome (SCOS)	MIK: 17123522
Varicocele	MIK: 14634417
Oligozoospermia	MIK: 19146781
Gamete quality	MIK: 10946867
Azoospermia	MIK: 24665877
Hypospermatogenesis	MIK: 17123522
Female infertility	INFBASE: 10966981
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Connective tissue diseases	GAD: 19527514
Chronic idiopathic neutropenia	GAD: 19614955
Abnormal seminal plasma	MIK: 23422491
Abnormal sperm	MIK: 15979995
Varicocoele	MIK: 20165911
Gamete quality	MIK: 10946867
Hypospermatogenesis	MIK: 17123522
Maturation arrest	MIK: 17123522
Sertoli cell-only syndrome	MIK: 17123522
Azoospermia	MIK: 28942044
Oligozoospermia	MIK: 17491259
Varicocele	MIK: 14634417

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23422491	Male infertility			72 (24 were normal, 48 abnormal)	Male infertility	FAS FASL
23422491	Semen analysis	CAG and GGN polymorphisms		72 (24 were normal, 48 abnormal)	Male infertility	FAS FASLG
19146781	Idiopathic azoospermia or severe oligozoospermia	FAS -1377G/A and -670A/G SNP and FASLG -844C/T	Han Chi nese	449 (203 infertile men with idiopathic azoospermia or severe oligozoospermia, 246 proven fertile controls)	Male infertility	FAS FASLG
17491259	Idiopathic azoospermia, severe oligozoospermia	FASL-844 CT and TT genotypes	Han Chi nese	420 (184 infertile patients with idiopathic azoospermia or severe oligozoospermia, 236 normal fertile male controls)	Male infertility
17123522	Hypospermatogenesis, such as maturation arrest (MA) and Sertoli cell-only syndrome (SCO)			22 (12 men with nonobstructive azoospermia, 10 men with obstructive azoospermia)	Male infertility
15979995	Abnormal serum				Male infertility
14634417	Male infertility with varicocele			120 (27 oligozoospermic men with varicocele, 59 oligozoospermic men without varicocele and 34 normal volunteers)	Male infertility	Fas FasL
24665877	Idiopathic azoospermia	FAS -670AG, FAS1377, FASLG -124A/G	Anatoli a, Turk ey	233 (108 infertile men with idiopathic azoospermia, in 125 proven fertile controls)	Male infertility	FAS FASLG
23422491	Abnormal seminal plasma			72 (24 were normal, 48 abnormal)	Male infertility	FAS FASLG
15979995	Abnormal sperm				Male infertility	FasL matrilysin
14634417	Male infertility, varicocele			120 (27 oligozoospermic men with varicocele, 59 oligozoospermic men without varicocele and 34 normal volunteers)	Male infertility	Fas FasL
10946867	Gamete quality			20 (10 biopsies with postmeiotic germ cell arrest, 10 normal testis biopsies)	Male infertility	Fas FasL
20165911	Associated with varicocoele				Male infertility
28942044	Idiopathic azoospermia, Male infertility	FAS-670A/G and FASL-844C/T polymorphisms		212 (102 infertile men, 110 normal fertile men as control group)	Male infertility
20378615	Oligozoospermia or azoospermia	rs763110	Europea n	442 (158 normospermic controls, 63 moderately oligozoospermic samples, 141 severe oligozoospermic samples and 80 non-obstructed azoospermic samples)	Male infertility	GWAS