• Gene id: 3559

Gene Summary

• Gene Symbol: IL2RA   Gene   UCSC   Ensembl
• Aliases: CD25, IDDM10, IL2R, IMD41, TCGFR, p55
• Gene name: interleukin 2 receptor subunit alpha
• Alternate names: interleukin-2 receptor subunit alpha, IL-2 receptor subunit alpha, IL-2R subunit alpha, TAC antigen, interleukin 2 receptor, alpha,
• Gene location: 10p15.1 (6062369: 6010693)     Exons: 8     NC_000010.11
• Gene summary(Entrez): The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2R
• OMIM: 147730

Protein Summary

• Protein general information: P01589  
  • Name: Interleukin 2 receptor subunit alpha (IL 2 receptor subunit alpha) (IL 2 RA) (IL 2R subunit alpha) (IL2 RA) (TAC antigen) (p55) (CD antigen CD25)
  • Length: 272  
  • Mass: 30,819
• Sequence:

  MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSS
  WDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYY
  QCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTE
  MAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI

• Structural information:
  • Protein Domains: Sushi (22-84)
    Sushi (123-186)
  • Interpro: IPR015486  IPR035976  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • PDB: 1ILM 1ILN 1Z92 2B5I 2ERJ 3IU3 3NFP
  • PDBsum: 1ILM 1ILN 1Z92 2B5I 2ERJ 3IU3 3NFP
  • DIP: 1080
  • STRING: ENSP00000369293
• Other Databases: GeneCards:  IL2RA  Malacards:  IL2RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological process
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological process
GO:0002664	regulation of T cell tolerance induction	IMP	biological process
GO:0004911	interleukin-2 receptor activity	IEA	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006924	activation-induced cell death of T cells	IEA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0008283	cell proliferation	TAS	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019976	interleukin-2 binding	IBA	molecular function
GO:0038110	interleukin-2-mediated signaling pathway	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IEA	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0046013	regulation of T cell homeostatic proliferation	IEA	biological process
GO:0050687	negative regulation of defense response to virus	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050777	negative regulation of immune response	IEA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological process
GO:0002664	regulation of T cell tolerance induction	IMP	biological process
GO:0004911	interleukin-2 receptor activity	IEA	molecular function
GO:0004911	interleukin-2 receptor activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006924	activation-induced cell death of T cells	IEA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0008283	cell proliferation	TAS	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019976	interleukin-2 binding	IBA	molecular function
GO:0038110	interleukin-2-mediated signaling pathway	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IEA	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0046013	regulation of T cell homeostatic proliferation	IEA	biological process
GO:0050672	negative regulation of lymphocyte proliferation	IEA	biological process
GO:0050687	negative regulation of defense response to virus	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050777	negative regulation of immune response	IEA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0002664	regulation of T cell tolerance induction	IMP	biological process
GO:0004911	interleukin-2 receptor activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0019976	interleukin-2 binding	IBA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04144	Endocytosis
hsa04640	Hematopoietic cell lineage
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa05200	Pathways in cancer
hsa05166	Human T-cell leukemia virus 1 infection
hsa05162	Measles

Diseases

Associated diseases	References
Crohn's disease	GAD: 21102463
Hyperparathyroidism	GAD: 20424473
Graves disease	GAD: 17371467
Graves disease	GAD: 17371467
Addison's disease	GAD: 18593762
Inflammation	GAD: 22228203
Addison's disease	GAD: 18593762
Celiac Disease	GAD: 19240061
Arthritis	GAD: 19565500
Alopecia areata	GAD: 20596022
Crohn's disease	GAD: 21102463
Multiple sclerosis	GAD: 18650830
Multiple sclerosis	GAD: 19231135
Multiple sclerosis	GAD: 19506219
Multiple sclerosis	GAD: 21833088
Rheumatoid arthritis	GAD: 19116909
Inflammatory bowel disease	GAD: 19471255
Arthritis	GAD: 19116909
Celiac disease	GAD: 19240061
Multiple sclerosis	GAD: 18354419
Systemic lupus erythematosus (SLE)	GAD: 19265545
Immunodeficiency	OMIM: 147730
Autoimmune diseases	GAD: 20410501
Inflammatory bowel disease	GAD: 19471255
Diabetes	GAD: 15776395
Diabetes	GAD: 21829393
Diabetes	GAD: 22293688
Diabetes	GAD: 15776395
Giant cell arteritis	GAD: 20810507
Alzheimer's disease	GAD: 16385451
Alzheimer's disease	GAD: 16385451
Implantation failure	INFBASE: 15105393
Miscarriage	INFBASE: 21314851
Reproductive disorderes	INFBASE: 23173675
Endometriosis	INFBASE: 19602517
Pregnancy loss	INFBASE: 22436290
Unexplained infertility	INFBASE: 10224804
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 10579621
Unexplained infertility	INFBASE: 10224804
Sterility	MIK: 2853120
Male factor infertility	MIK: 9272207
Asthenozoospermia	MIK: 8046017
Low sperm motility	MIK: 8046017
Male factor infertility	MIK: 9262280
Low sperm motility	MIK: 8046017
Male factor infertility	MIK: 9262280
Male factor infertility	MIK: 2853120
Female infertility	INFBASE: 23173675
Asthma	GAD: 20599261
Vitiligo	GAD: 20410501
Vitiligo	GAD: 20410501
Connective tissue diseases	GAD: 19527514
Connective tissue diseases	GAD: 19527514
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Asthenozoospermia	MIK: 8046017
Male infertility	MIK: 11232795

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
9272207	Male infertility			38 (18 fertile subjects, 20 infertile subjects)	Male infertlity	IL-4 IL-2R IL-6
11232795	Male infertility				Male infertility
8046017	Low sperm motility, asthenozoospermic			86 (20 controls, 30 pure asthenozoospermia, 36 oligoteratoasthenozoospermia)	Male infertility	IL-1 IL-6 IL-2 receptors
9262280	Male infertility			140 (21 fertile subjects, 119 patients with a range of andrological diseases)	Male infertility	IL-beta IL-2 IL-6 sR IL-2 SR IL-6
2853120	Sterility				Male infertility	T8 antigen IL2-R
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq