• Gene id: 3558

Gene Summary

• Gene Symbol: IL2   Gene   UCSC   Ensembl
• Aliases: IL-2, TCGF, lymphokine
• Gene name: interleukin 2
• Alternate names: interleukin-2, T cell growth factor, aldesleukin, involved in regulation of T-cell clonal expansion,
• Gene location: 4q27 (122456494: 122449478)     Exons: 5     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a secreted cytokine that is important for the proliferation of T and B lymphocytes. The receptor of this cytokine is a heterotrimeric protein complex whose gamma chain is also shared by interleukin 4 (IL4) and interleuk
• OMIM: 147680

Protein Summary

• Protein general information: P60568  
  • Name: Interleukin 2 (IL 2) (T cell growth factor) (TCGF) (Aldesleukin)
  • Length: 153  
  • Mass: 17,628
• Sequence:

  MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKH
  LQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIIS
  TLT

• Structural information:
  • Interpro: IPR009079  IPR000779  IPR030477  
  • Prosite: PS00424
  • PDB: 1ILM 1ILN 1IRL 1M47 1M48 1M49 1M4A 1M4B 1M4C 1NBP 1PW6 1PY2 1QVN 1Z92 2B5I 2ERJ 3INK 3QAZ 3QB1 4NEJ 4NEM 5LQB 5M5E
  • PDBsum: 1ILM 1ILN 1IRL 1M47 1M48 1M49 1M4A 1M4B 1M4C 1NBP 1PW6 1PY2 1QVN 1Z92 2B5I 2ERJ 3INK 3QAZ 3QB1 4NEJ 4NEM 5LQB 5M5E
  • DIP: 475
  • STRING: ENSP00000226730
• Other Databases: GeneCards:  IL2  Malacards:  IL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005134	interleukin-2 receptor binding	TAS	molecular function
GO:0005134	interleukin-2 receptor binding	IDA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008083	growth factor activity	TAS	molecular function
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0019209	kinase activator activity	TAS	molecular function
GO:0030101	natural killer cell activation	TAS	biological process
GO:0030217	T cell differentiation	TAS	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030307	positive regulation of cell growth	TAS	biological process
GO:0030890	positive regulation of B cell proliferation	IDA	biological process
GO:0031851	kappa-type opioid receptor binding	IEA	molecular function
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043208	glycosphingolipid binding	IEA	molecular function
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045591	positive regulation of regulatory T cell differentiation	IEA	biological process
GO:0045822	negative regulation of heart contraction	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046013	regulation of T cell homeostatic proliferation	IEA	biological process
GO:0048304	positive regulation of isotype switching to IgG isotypes	IEA	biological process
GO:0050672	negative regulation of lymphocyte proliferation	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005134	interleukin-2 receptor binding	IEA	molecular function
GO:0005134	interleukin-2 receptor binding	IEA	molecular function
GO:0005134	interleukin-2 receptor binding	TAS	molecular function
GO:0005134	interleukin-2 receptor binding	IDA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0019209	kinase activator activity	TAS	molecular function
GO:0030101	natural killer cell activation	TAS	biological process
GO:0030217	T cell differentiation	TAS	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030307	positive regulation of cell growth	TAS	biological process
GO:0030890	positive regulation of B cell proliferation	IDA	biological process
GO:0031851	kappa-type opioid receptor binding	IEA	molecular function
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IEA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043208	glycosphingolipid binding	IEA	molecular function
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0045591	positive regulation of regulatory T cell differentiation	IEA	biological process
GO:0045822	negative regulation of heart contraction	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046013	regulation of T cell homeostatic proliferation	IEA	biological process
GO:0048304	positive regulation of isotype switching to IgG isotypes	IEA	biological process
GO:0050672	negative regulation of lymphocyte proliferation	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005134	interleukin-2 receptor binding	TAS	molecular function
GO:0005134	interleukin-2 receptor binding	IDA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008083	growth factor activity	TAS	molecular function
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0019209	kinase activator activity	TAS	molecular function
GO:0030101	natural killer cell activation	TAS	biological process
GO:0030217	T cell differentiation	TAS	biological process
GO:0030307	positive regulation of cell growth	TAS	biological process
GO:0030890	positive regulation of B cell proliferation	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04672	Intestinal immune network for IgA production
hsa05200	Pathways in cancer
hsa05320	Autoimmune thyroid disease
hsa05321	Inflammatory bowel disease
hsa05330	Allograft rejection
hsa05332	Graft-versus-host disease
hsa04940	Type I diabetes mellitus
hsa05135	Yersinia infection
hsa05166	Human T-cell leukemia virus 1 infection
hsa05162	Measles
hsa05142	Chagas disease

Diseases

Associated diseases	References
Cancer	GAD: 19773451
Cancer (bladder)	GAD: 16938461
Cancer (esophageal)	GAD: 19801321
Cancer (Hepatocellular)	GAD: 19126646
Cancer (leiomyoma)	GAD: 17222831
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 17327408
Cancer (melanoma)	GAD: 14675394
Cancer (myeloma)	GAD: 20568250
Cancer (nasopharyngeal)	GAD: 20438365
Cancer (non-Hodgkin lymphoma)	GAD: 16389181
Cancer (prostate)	GAD: 17115417
Cancer (Squamous cell)	GAD: 19495883
Cancer (stomach)	GAD: 16885196
Cancer (uterine cervical)	GAD: 18628433
Cancer (breast)	GAD: 20418110
Cardiovascular disease	GAD: 18543227
Atherosclerosis	GAD: 20485444
Cystic fibrosis	GAD: 17336597
Irritable bowel syndrome	GAD: 20177758
Gastric atrophy	GAD: 15904474
Hyperparathyroidism	GAD: 20424473
Graves disease	GAD: 20960273
Graves ophthalmopathy	GAD: 19798110
Sarcoidosis	GAD: 21086908
Lymphoproliferative disorders	GAD: 16824159
Hodgkin disease	GAD: 21061265
Idiopathic thrombocytopenic purpura	GAD: 20626741
Addison's disease	GAD: 18593762
Aggressive periodontitis	GAD: 19453859
Allergy	GAD: 11354638
Alopecia areata	GAD: 20596022
Anti-Neutrophil Cytoplasmic Antibody-Associated Vasculitis	GAD: 19951419
Arthritis	GAD: 11315919
Asthma	GAD: 12121273
Celiac disease	GAD: 17558408
Celiac disease	GAD: 19693089
Crohn's disease	GAD: 18942754
Ulcerative colitis	GAD: 18942754
Rheumatoid arthritis	GAD: 15895884
Multiple sclerosis	GAD: 11525806
Psoriasis	GAD: 17714919
Scleroderma	GAD: 18576303
Systemic lupus erythematosus (SLE)	GAD: 18650128
Severe combined immunodeficiencies	OMIM: 147680
Atopy	GAD: 15005726
Autoimmune diseases	GAD: 20082482
Inflammatory bowel disease	GAD: 19471255
Juvenile arthritis	GAD: 15170937
Common variable immunodeficiency	GAD: 19339796
Diabetes	GAD: 15361128
Diabetes	KEGG: H00408
Osteolysis	GAD: 19860911
Bone diseases	GAD: 20060205
Supranuclear palsy	GAD: 21685912
Alzheimer's disease	GAD: 19141999
Parkinson disease	GAD: 15120188
Schizophrenia	GAD: 16091861
Chronic renal failure	GAD: 21085059
Kidney diseases	GAD: 15104679
Chorioamnionitis	GAD: 20452482
Premature birth	GAD: 19141488
Preterm birth risk	GAD: 15951664
Pelvic endometriosis	INFBASE: 26871558
Endometriosis	INFBASE: 8607944
Female infertility	INFBASE: 17234676
Implantation failure	INFBASE: 18331736
External gential endometriosis	INFBASE: 16027877
Polycystic ovary syndrome (PCOS)	INFBASE: 25303485
Unexplained infertility	INFBASE: 12607776
Unexplained infertility	INFBASE: 12607776
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 7745063
Recurrent pregnancy loss (RPL)	INFBASE: 22349103
Oligoasthenozoospermia	MIK: 12619318
Leukocytospermia	MIK: 7789553
Male factor infertility	MIK: 8554429
Endometriosis-associated infertility	INFBASE: 2801830
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Interstitial lung diseases	GAD: 19117745
Pulmonary fibrosis	GAD: 16573560
Rhinitis	GAD: 22036096
Takayasu arteritis	GAD: 17002904
Pemphigus vulgaris	GAD: 19470040
Connective tissue diseases	GAD: 19527514
Barrett's esophagus	GAD: 18192685
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Leukocytospermia	MIK: 7789553
Oligoasthenozoospermia	MIK: 12619318
Male infertility	MIK: 8554429
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12619318	Leukocytospermia, oligoasthenozoospermia			52 (16 fertile men, 16 with leukocytospermia, 20 with oligoasthenozoospermia)	Male infertility	IL-2 IL-6
8554429	Male infertility			43 (20 with proven fertility, 23 with male infertility)	Male infertility
9262280	Male infertility			140 (21 fertile subjects, 119 patients with a range of andrological diseases)	Male infertility	IL-beta IL-2 IL-6 sR IL-2 SR IL-6
7789553	Leukocytospermia				Male infertility	Elastase SOD IL2 IL-8
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881