About Us

Search Result


Gene id 3558
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol IL2   Gene   UCSC   Ensembl
Aliases IL-2, TCGF, lymphokine
Gene name interleukin 2
Alternate names interleukin-2, T cell growth factor, aldesleukin, involved in regulation of T-cell clonal expansion,
Gene location 4q27 (122456494: 122449478)     Exons: 5     NC_000004.12
Gene summary(Entrez) The protein encoded by this gene is a secreted cytokine that is important for the proliferation of T and B lymphocytes. The receptor of this cytokine is a heterotrimeric protein complex whose gamma chain is also shared by interleukin 4 (IL4) and interleuk
OMIM 147680

Protein Summary

Protein general information P60568  

Name: Interleukin 2 (IL 2) (T cell growth factor) (TCGF) (Aldesleukin)

Length: 153  Mass: 17,628

Sequence MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKH
LQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIIS
TLT
Structural information
Interpro:  IPR009079  IPR000779  IPR030477  
Prosite:   PS00424

PDB:  
1ILM 1ILN 1IRL 1M47 1M48 1M49 1M4A 1M4B 1M4C 1NBP 1PW6 1PY2 1QVN 1Z92 2B5I 2ERJ 3INK 3QAZ 3QB1 4NEJ 4NEM 5LQB 5M5E
PDBsum:   1ILM 1ILN 1IRL 1M47 1M48 1M49 1M4A 1M4B 1M4C 1NBP 1PW6 1PY2 1QVN 1Z92 2B5I 2ERJ 3INK 3QAZ 3QB1 4NEJ 4NEM 5LQB 5M5E

DIP:  

475

STRING:   ENSP00000226730
Other Databases GeneCards:  IL2  Malacards:  IL2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000165 MAPK cascade
TAS biological process
GO:0001933 negative regulation of pr
otein phosphorylation
IEA biological process
GO:0002250 adaptive immune response
IEA biological process
GO:0002903 negative regulation of B
cell apoptotic process
IDA biological process
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular function
GO:0005125 cytokine activity
IDA molecular function
GO:0005125 cytokine activity
IDA molecular function
GO:0005134 interleukin-2 receptor bi
nding
TAS molecular function
GO:0005134 interleukin-2 receptor bi
nding
IDA molecular function
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
TAS cellular component
GO:0005829 cytosol
IEA cellular component
GO:0006955 immune response
TAS biological process
GO:0007155 cell adhesion
TAS biological process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IEA biological process
GO:0007205 protein kinase C-activati
ng G-protein coupled rece
ptor signaling pathway
IEA biological process
GO:0007267 cell-cell signaling
TAS biological process
GO:0008083 growth factor activity
TAS molecular function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological process
GO:0019209 kinase activator activity
TAS molecular function
GO:0030101 natural killer cell activ
ation
TAS biological process
GO:0030217 T cell differentiation
TAS biological process
GO:0030246 carbohydrate binding
IEA molecular function
GO:0030307 positive regulation of ce
ll growth
TAS biological process
GO:0030890 positive regulation of B
cell proliferation
IDA biological process
GO:0031851 kappa-type opioid recepto
r binding
IEA molecular function
GO:0032729 positive regulation of in
terferon-gamma production
IEA biological process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological process
GO:0034105 positive regulation of ti
ssue remodeling
IC biological process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
IDA biological process
GO:0043066 negative regulation of ap
optotic process
TAS biological process
GO:0043208 glycosphingolipid binding
IEA molecular function
GO:0043547 positive regulation of GT
Pase activity
IEA biological process
GO:0045471 response to ethanol
IEA biological process
GO:0045591 positive regulation of re
gulatory T cell different
iation
IEA biological process
GO:0045822 negative regulation of he
art contraction
IEA biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IEA biological process
GO:0046013 regulation of T cell home
ostatic proliferation
IEA biological process
GO:0048304 positive regulation of is
otype switching to IgG is
otypes
IEA biological process
GO:0050672 negative regulation of ly
mphocyte proliferation
IEA biological process
GO:0050728 negative regulation of in
flammatory response
IEA biological process
GO:0050729 positive regulation of in
flammatory response
IC biological process
GO:0051024 positive regulation of im
munoglobulin secretion
IEA biological process
GO:0060999 positive regulation of de
ndritic spine development
IEA biological process
GO:0097192 extrinsic apoptotic signa
ling pathway in absence o
f ligand
IEA biological process
GO:0000165 MAPK cascade
TAS biological process
GO:0001933 negative regulation of pr
otein phosphorylation
IEA biological process
GO:0001934 positive regulation of pr
otein phosphorylation
IEA biological process
GO:0002250 adaptive immune response
IEA biological process
GO:0002376 immune system process
IEA biological process
GO:0002903 negative regulation of B
cell apoptotic process
IDA biological process
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular function
GO:0005125 cytokine activity
IEA molecular function
GO:0005125 cytokine activity
IEA molecular function
GO:0005125 cytokine activity
IDA molecular function
GO:0005125 cytokine activity
IDA molecular function
GO:0005134 interleukin-2 receptor bi
nding
IEA molecular function
GO:0005134 interleukin-2 receptor bi
nding
IEA molecular function
GO:0005134 interleukin-2 receptor bi
nding
TAS molecular function
GO:0005134 interleukin-2 receptor bi
nding
IDA molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
IEA cellular component
GO:0005615 extracellular space
IEA cellular component
GO:0005615 extracellular space
TAS cellular component
GO:0005829 cytosol
IEA cellular component
GO:0006955 immune response
IEA biological process
GO:0006955 immune response
TAS biological process
GO:0007155 cell adhesion
TAS biological process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IEA biological process
GO:0007205 protein kinase C-activati
ng G-protein coupled rece
ptor signaling pathway
IEA biological process
GO:0007267 cell-cell signaling
TAS biological process
GO:0008083 growth factor activity
IEA molecular function
GO:0008083 growth factor activity
IEA molecular function
GO:0008083 growth factor activity
TAS molecular function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological process
GO:0019209 kinase activator activity
TAS molecular function
GO:0030101 natural killer cell activ
ation
TAS biological process
GO:0030217 T cell differentiation
TAS biological process
GO:0030246 carbohydrate binding
IEA molecular function
GO:0030307 positive regulation of ce
ll growth
TAS biological process
GO:0030890 positive regulation of B
cell proliferation
IDA biological process
GO:0031851 kappa-type opioid recepto
r binding
IEA molecular function
GO:0032729 positive regulation of in
terferon-gamma production
IEA biological process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological process
GO:0034105 positive regulation of ti
ssue remodeling
IC biological process
GO:0042102 positive regulation of T
cell proliferation
IEA biological process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IEA biological process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
IEA biological process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
IDA biological process
GO:0043066 negative regulation of ap
optotic process
TAS biological process
GO:0043208 glycosphingolipid binding
IEA molecular function
GO:0043547 positive regulation of GT
Pase activity
IEA biological process
GO:0045471 response to ethanol
IEA biological process
GO:0045582 positive regulation of T
cell differentiation
IEA biological process
GO:0045591 positive regulation of re
gulatory T cell different
iation
IEA biological process
GO:0045822 negative regulation of he
art contraction
IEA biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IEA biological process
GO:0046013 regulation of T cell home
ostatic proliferation
IEA biological process
GO:0048304 positive regulation of is
otype switching to IgG is
otypes
IEA biological process
GO:0050672 negative regulation of ly
mphocyte proliferation
IEA biological process
GO:0050728 negative regulation of in
flammatory response
IEA biological process
GO:0050729 positive regulation of in
flammatory response
IC biological process
GO:0051024 positive regulation of im
munoglobulin secretion
IEA biological process
GO:0060999 positive regulation of de
ndritic spine development
IEA biological process
GO:0097192 extrinsic apoptotic signa
ling pathway in absence o
f ligand
IEA biological process
GO:0000165 MAPK cascade
TAS biological process
GO:0002903 negative regulation of B
cell apoptotic process
IDA biological process
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular function
GO:0005125 cytokine activity
IDA molecular function
GO:0005125 cytokine activity
IDA molecular function
GO:0005134 interleukin-2 receptor bi
nding
TAS molecular function
GO:0005134 interleukin-2 receptor bi
nding
IDA molecular function
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
TAS cellular component
GO:0006955 immune response
TAS biological process
GO:0007155 cell adhesion
TAS biological process
GO:0007267 cell-cell signaling
TAS biological process
GO:0008083 growth factor activity
TAS molecular function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological process
GO:0019209 kinase activator activity
TAS molecular function
GO:0030101 natural killer cell activ
ation
TAS biological process
GO:0030217 T cell differentiation
TAS biological process
GO:0030307 positive regulation of ce
ll growth
TAS biological process
GO:0030890 positive regulation of B
cell proliferation
IDA biological process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological process
GO:0034105 positive regulation of ti
ssue remodeling
IC biological process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
IDA biological process
GO:0043066 negative regulation of ap
optotic process
TAS biological process
GO:0050729 positive regulation of in
flammatory response
IC biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa04060Cytokine-cytokine receptor interaction
hsa04061Viral protein interaction with cytokine and cytokine receptor
hsa04625C-type lectin receptor signaling pathway
hsa04660T cell receptor signaling pathway
hsa04658Th1 and Th2 cell differentiation
hsa04659Th17 cell differentiation
hsa04672Intestinal immune network for IgA production
hsa05200Pathways in cancer
hsa05320Autoimmune thyroid disease
hsa05321Inflammatory bowel disease
hsa05330Allograft rejection
hsa05332Graft-versus-host disease
hsa04940Type I diabetes mellitus
hsa05135Yersinia infection
hsa05166Human T-cell leukemia virus 1 infection
hsa05162Measles
hsa05142Chagas disease
Associated diseases References
Cancer GAD: 19773451
Cancer (bladder) GAD: 16938461
Cancer (esophageal) GAD: 19801321
Cancer (Hepatocellular) GAD: 19126646
Cancer (leiomyoma) GAD: 17222831
Cancer (lung) GAD: 18676680
Cancer (lymphoma) GAD: 17327408
Cancer (melanoma) GAD: 14675394
Cancer (myeloma) GAD: 20568250
Cancer (nasopharyngeal) GAD: 20438365
Cancer (non-Hodgkin lymphoma) GAD: 16389181
Cancer (prostate) GAD: 17115417
Cancer (Squamous cell) GAD: 19495883
Cancer (stomach) GAD: 16885196
Cancer (uterine cervical) GAD: 18628433
Cancer (breast) GAD: 20418110
Cardiovascular disease GAD: 18543227
Atherosclerosis GAD: 20485444
Cystic fibrosis GAD: 17336597
Irritable bowel syndrome GAD: 20177758
Gastric atrophy GAD: 15904474
Hyperparathyroidism GAD: 20424473
Graves disease GAD: 20960273
Graves ophthalmopathy GAD: 19798110
Sarcoidosis GAD: 21086908
Lymphoproliferative disorders GAD: 16824159
Hodgkin disease GAD: 21061265
Idiopathic thrombocytopenic purpura GAD: 20626741
Addison's disease GAD: 18593762
Aggressive periodontitis GAD: 19453859
Allergy GAD: 11354638
Alopecia areata GAD: 20596022
Anti-Neutrophil Cytoplasmic Antibody-Associated Vasculitis GAD: 19951419
Arthritis GAD: 11315919
Asthma GAD: 12121273
Celiac disease GAD: 17558408
Celiac disease GAD: 19693089
Crohn's disease GAD: 18942754
Ulcerative colitis GAD: 18942754
Rheumatoid arthritis GAD: 15895884
Multiple sclerosis GAD: 11525806
Psoriasis GAD: 17714919
Scleroderma GAD: 18576303
Systemic lupus erythematosus (SLE) GAD: 18650128
Severe combined immunodeficiencies OMIM: 147680
Atopy GAD: 15005726
Autoimmune diseases GAD: 20082482
Inflammatory bowel disease GAD: 19471255
Juvenile arthritis GAD: 15170937
Common variable immunodeficiency GAD: 19339796
Diabetes GAD: 15361128
Diabetes KEGG: H00408
Osteolysis GAD: 19860911
Bone diseases GAD: 20060205
Supranuclear palsy GAD: 21685912
Alzheimer's disease GAD: 19141999
Parkinson disease GAD: 15120188
Schizophrenia GAD: 16091861
Chronic renal failure GAD: 21085059
Kidney diseases GAD: 15104679
Chorioamnionitis GAD: 20452482
Premature birth GAD: 19141488
Preterm birth risk GAD: 15951664
Pelvic endometriosis INFBASE: 26871558
Endometriosis INFBASE: 8607944
Female infertility INFBASE: 17234676
Implantation�failure INFBASE: 18331736
External gential endometriosis INFBASE: 16027877
Polycystic ovary syndrome (PCOS) INFBASE: 25303485
Unexplained infertility INFBASE: 12607776
Unexplained infertility INFBASE: 12607776
Ovarian hyperstimulation syndrome (OHSS) INFBASE: 7745063
Recurrent pregnancy loss (RPL) INFBASE: 22349103
Oligoasthenozoospermia MIK: 12619318
Leukocytospermia MIK: 7789553
Male factor infertility MIK: 8554429
Endometriosis-associated�infertility INFBASE: 2801830
Chronic obstructive pulmonary disease (COPD) GAD: 19625176
Interstitial lung diseases GAD: 19117745
Pulmonary fibrosis GAD: 16573560
Rhinitis GAD: 22036096
Takayasu arteritis GAD: 17002904
Pemphigus vulgaris GAD: 19470040
Connective tissue diseases GAD: 19527514
Barrett's esophagus GAD: 18192685
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Leukocytospermia MIK: 7789553
Oligoasthenozoospermia MIK: 12619318
Male infertility MIK: 8554429
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
12619318 Leukocytos
permia, ol
igoastheno
zoospermia

52 (16 fertile
men, 16 with le
ukocytospermia,
20 with oligoa
sthenozoospermi
a)
Male infertility IL-2
IL-6
Show abstract
8554429 Male infer
tility

43 (20 with pro
ven fertility,
23 with male in
fertility)
Male infertility
Show abstract
9262280 Male infer
tility

140 (21 fertile
subjects, 119
patients with a
range of andro
logical disease
s)
Male infertility IL-beta
IL-2
IL-6
sR IL-2
SR IL-6
Show abstract
7789553 Leukocytos
permia


Male infertility Elastase
SOD
IL2
IL-8
Show abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract