Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 3557
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol IL1RN   Gene   UCSC   Ensembl
Aliases DIRA, ICIL-1RA, IL-1RN, IL-1ra, IL-1ra3, IL1F3, IL1RA, IRAP, MVCD4
Gene name interleukin 1 receptor antagonist
Alternate names interleukin-1 receptor antagonist protein, IL1 inhibitor, intracellular IL-1 receptor antagonist type II, intracellular interleukin-1 receptor antagonist (icIL-1ra), type II interleukin-1 receptor antagonist,
Gene location 2q14.1 (113099364: 113134015)     Exons: 11     NC_000002.12
Gene summary(Entrez) The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory
OMIM 147679

Protein Summary
Protein general information P18510  

Name: Interleukin 1 receptor antagonist protein (IL 1RN) (IL 1ra) (IRAP) (ICIL 1RA) (IL1 inhibitor) (Anakinra)

Length: 177  Mass: 20,055

Tissue specificity: Isoform 2 is strongly detected in adult heart, fetal skeletal muscles and fetal heart. Isoform 1 is weakly detected in fetal heart and also in fetal skeletal muscle. Isoform 1 and isoform 2 are detected in adult bladder (at protein lev

Sequence MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVP
IEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAM
EADQPVSLTNMPDEGVMVTKFYFQEDE
Structural information
Interpro:  IPR020877  IPR000975  IPR003297  IPR008996  
Prosite:   PS00253

PDB:  		 1ILR 1ILT 1IRA 1IRP 1ITN 2IRT
PDBsum:   1ILR 1ILT 1IRA 1IRP 1ITN 2IRT
STRING:   ENSP00000259206
Other Databases GeneCards:  IL1RN  Malacards:  IL1RN

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0001960 negative regulation of cy
tokine-mediated signaling
pathway
 IEA biological process
GO:0005125 cytokine activity
 IBA molecular function
GO:0005149 interleukin-1 receptor bi
nding
 IDA molecular function
GO:0005150 interleukin-1, Type I rec
eptor binding
 IPI molecular function
GO:0005151 interleukin-1, Type II re
ceptor binding
 IPI molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 IDA molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 IDA molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005622 intracellular
 NAS cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006629 lipid metabolic process
 IEA biological process
GO:0006953 acute-phase response
 IDA biological process
GO:0006955 immune response
 NAS biological process
GO:0030073 insulin secretion
 IEA biological process
GO:0034115 negative regulation of he
terotypic cell-cell adhes
ion
 IDA biological process
GO:0045352 interleukin-1 Type I rece
ptor antagonist activity
 IDA molecular function
GO:0045353 interleukin-1 Type II rec
eptor antagonist activity
 IDA molecular function
GO:0051384 response to glucocorticoi
d
 IDA biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:2000660 negative regulation of in
terleukin-1-mediated sign
aling pathway
 IDA biological process
GO:2000660 negative regulation of in
terleukin-1-mediated sign
aling pathway
 IDA biological process
GO:0001960 negative regulation of cy
tokine-mediated signaling
pathway
 IEA biological process
GO:0005125 cytokine activity
 IBA molecular function
GO:0005149 interleukin-1 receptor bi
nding
 IEA molecular function
GO:0005149 interleukin-1 receptor bi
nding
 IDA molecular function
GO:0005150 interleukin-1, Type I rec
eptor binding
 IPI molecular function
GO:0005151 interleukin-1, Type II re
ceptor binding
 IPI molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 IEA molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 IDA molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 IDA molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005576 extracellular region
 IEA cellular component
GO:0005576 extracellular region
 IEA cellular component
GO:0005576 extracellular region
 IEA cellular component
GO:0005615 extracellular space
 IEA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005622 intracellular
 NAS cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006629 lipid metabolic process
 IEA biological process
GO:0006953 acute-phase response
 IDA biological process
GO:0006955 immune response
 NAS biological process
GO:0030073 insulin secretion
 IEA biological process
GO:0031982 vesicle
 IEA cellular component
GO:0034115 negative regulation of he
terotypic cell-cell adhes
ion
 IDA biological process
GO:0045352 interleukin-1 Type I rece
ptor antagonist activity
 IDA molecular function
GO:0045353 interleukin-1 Type II rec
eptor antagonist activity
 IDA molecular function
GO:0051384 response to glucocorticoi
d
 IDA biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:2000660 negative regulation of in
terleukin-1-mediated sign
aling pathway
 IDA biological process
GO:2000660 negative regulation of in
terleukin-1-mediated sign
aling pathway
 IDA biological process
GO:0005125 cytokine activity
 IBA molecular function
GO:0005149 interleukin-1 receptor bi
nding
 IDA molecular function
GO:0005150 interleukin-1, Type I rec
eptor binding
 IPI molecular function
GO:0005151 interleukin-1, Type II re
ceptor binding
 IPI molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 IDA molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 IDA molecular function
GO:0005152 interleukin-1 receptor an
tagonist activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005622 intracellular
 NAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006953 acute-phase response
 IDA biological process
GO:0006955 immune response
 NAS biological process
GO:0034115 negative regulation of he
terotypic cell-cell adhes
ion
 IDA biological process
GO:0045352 interleukin-1 Type I rece
ptor antagonist activity
 IDA molecular function
GO:0045353 interleukin-1 Type II rec
eptor antagonist activity
 IDA molecular function
GO:0051384 response to glucocorticoi
d
 IDA biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:2000660 negative regulation of in
terleukin-1-mediated sign
aling pathway
 IDA biological process
GO:2000660 negative regulation of in
terleukin-1-mediated sign
aling pathway
 IDA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04060Cytokine-cytokine receptor interaction

Diseases

Expand All | Collapse All
Associated diseases References
Cancer (esophageal) GAD: 18396210
Cancer (gastric) GAD: 12133467
Cancer (glaucoma) GAD: 12913327
Cancer (Hepatocellular) GAD: 20467172
Cancer (leiomyoma) GAD: 17222831
Cancer (leukemia) GAD: 19074885
Cancer (liver) GAD: 16172101
Cancer (lung) GAD: 16019127
Cancer (lymphoma) GAD: 17327408
Cancer (myeloma) GAD: 20568250
Cancer (non-Hodgkin lymphoma) GAD: 16389181
Cancer (ovarian) GAD: 12445604
Cancer (prostate) GAD: 16284379
Cancer (Squamous cell) GAD: 19495883
Cancer (stomach) GAD: 15579481
Cancer (vulvar) GAD: 14984963
Cancer GAD: 16389181
Cancer (Adenocarcinoma) GAD: 19399323
Cancer (bladder) GAD: 16938461
Cancer (cervical) GAD: 18333945
Cancer (colon) GAD: 18987561
Cancer (colorectal) GAD: 17454884
Cancer (breast) GAD: 19267917
Aneurysm GAD: 16268484
Angina pectoris GAD: 15171792
Apoplexy GAD: 20034444
Atherosclerosis GAD: 12958619
Atherosclerosis GAD: 16873708
Cardiovascular disease GAD: 15670034
Cerebral infarction GAD: 12901853
Hypertension GAD: 15476179
Myocardial Infarction GAD: 19811432
Myocardial Infarction GAD: 12082592
Brain ischemia GAD: 19729601
Restenosis GAD: 12082592
Thromboembolism GAD: 17413037
Omenn syndrome severe combined immunideficiency GAD: 17572155
Cystic fibrosis GAD: 19009622
Gastric disease GAD: 19295440
Irritable bowel syndrome GAD: 19844779
Primary biliary cirrhosis GAD: 11171832
Hashimoto disease GAD: 17115419
Graves ophthalmopathy GAD: 19702713
Graves disease GAD: 7530255
Pterygium GAD: 15184943
Uveitis GAD: 17005410
Keratoconus GAD: 19043479
Sarcoidosis GAD: 21086908
Mucocutaneous lymph node syndrome GAD: 21048327
Hodgkin disease GAD: 19573080
Idiopathic thrombocytopenic purpura GAD: 20626741
Kawasaki disease GAD: 15900570
Alopecia areata GAD: 8077705
Ankylosing spondylitis GAD: 11752505
Arthritis GAD: 12618859
Asthma GAD: 18763028
Atopy GAD: 15007345
Celiac disease GAD: 16078996
Chronic ulcerative colitis GAD: 11606494
Crohn's disease GAD: 18942754
Crohn's disease GAD: 11686217
Juvenile arthritis GAD: 15170937
Ulcerative colitis GAD: 10500062
Inflammatory bowel disease GAD: 9568467
Rheumatoid arthritis GAD: 11838837
Multiple sclerosis GAD: 10025794
Scleroderma GAD: 20603050
Periodontitis GAD: 12593203
Psoriasis GAD: 9039327
Systemic lupus erythematosus (SLE) GAD: 15535834
Systemic lupus erythematosus (SLE) GAD: 12111633
Autoimmune diseases GAD: 17964974
Behcet's disease GAD: 15679582
Bullous pemphigoid GAD: 16403098
Common variable immunodeficiency GAD: 19076825
Amyloidosis GAD: 19026124
Diabetes GAD: 7605869
Obesity GAD: 16318998
Biliary cirrhosis GAD: 15884119
Achondroplasia GAD: 12105837
Degenerative arthropathy GAD: 20237151
Osteoarthritis GAD: 19036616
Osteolysis GAD: 18821666
Osteoporosis GAD: 18551993
Osteoporosis GAD: 10750554
Ankylosing spondylitis GAD: 18484691
Bone diseases GAD: 11033452
Knee osteoarthritis GAD: 19934104
Rheumatic diseases GAD: 16043936
Polymyalgia rheumatica GAD: 11138328
Febrile Seizures GAD: 19135625
Stroke GAD: 19811433
Subarachnoid hemorrhage GAD: 20495422
Alzheimer's disease GAD: 15201366
Epilepsy GAD: 19066720
Parkinson disease GAD: 20427258
Brain edema GAD: 16217062
Acute pancreatitis GAD: 10766448
Depression GAD: 18728809
Dysthymia GAD: 14997019
Mood disorders GAD: 18832862
Psychological disorders GAD: 18728809
Schizophrenia GAD: 18583979
Autism GAD: 19058789
Bipolar disorder GAD: 19125864
Chronic renal failure GAD: 20551628
Abortion GAD: 12609525
Abruptio placentae GAD: 18423886
Chorioamnionitis GAD: 20452482
Endometriosis GAD: 17177339
Preeclampsia GAD: 12044341
Premature birth GAD: 18754838
Male factor infertility MIK: 23251650
Chronic obstructive pulmonary disease (COPD) GAD: 18364273
Silicosis GAD: 17290743
Interstitial lung diseases GAD: 19117745
Lung disease GAD: 18545091
Pulmonary fibrosis GAD: 16573560
Rhinitis GAD: 14533660
Dermatitis GAD: 18416755
Erythema GAD: 12626603
Vitiligo GAD: 19129082
Pemphigus vulgaris GAD: 19470040
Connective tissue diseases GAD: 19527514
Early onset periodontitis GAD: 12445219
Periodontal disease GAD: 16423338
Gingivitis GAD: 17448214
Adult onset still's disease GAD: 17963170
Alveolar Bone Loss GAD: 19053923
Atrophy GAD: 19448967
Atrophy GAD: 19448967
Duodenal ulcer GAD: 19804405
Microvascular complications of diabetes OMIM: 147679
Cachexia GAD: 17359523
Nephrolithiasis GAD: 17258699
Nephropathy GAD: 8786086
Nephrotic syndrome GAD: 14758530
Urolithiasis GAD: 18186699
Vulvar vestibulitis syndrome GAD: 15305821
Oligohydramnios GAD: 18771989
Incomplete maturation arrest (IMA) MIK: 21235388
Sertoli only syndrome (SOS) MIK: 21235388
Male infertility MIK: 23251650
Spermatogenic defects MIK: 23869807
Spermatogenic failure MIK: 23869807
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23869807 Spermatoge
nic failur
e, inferti
lity
20 (16 idiopath
ic non-obstruct
ive azoospermia
, 4 normal sper
matogenesis )
 Male infertility IL1-R1
CASP1
SCF
 Show abstract
17215863 Imparied h
uman sperm
atogenesis

Male infertility IL-1alpha
IL-1RA
IL-1
IL-18
 Show abstract
23869807 Spermatoge
nic defect
s
20 (16 patients
with various t
ypes of NOA, 4
with normal spe
rmatogenesis)
 Male infertility IL1-R1
CASP1
SCF
IL1-RA
 Show abstract
21235388 Incomplete
maturatio
n arrest (
IMA), Sert
oli only s
yndrome (S
OS)

Male infertility IL-?
IL-1ra
 Show abstract
29968322 Idiopathic
male infe
rtility
 VNTR Iranian
 460 (230 infert
ile, 230 health
y men)
 Male infertility
Show abstract
23251650 Male infer
tility
689 (331 idiopa
thic infertile
patients, 358 f
ertile healthy
men)
 Male infertility
Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract