• Gene id: 3556

Gene Summary

• Gene Symbol: IL1RAP   Gene   UCSC   Ensembl
• Aliases: C3orf13, IL-1RAcP, IL1R3
• Gene name: interleukin 1 receptor accessory protein
• Alternate names: interleukin-1 receptor accessory protein, IL-1 receptor accessory protein, interleukin-1 receptor 3, interleukin-1 receptor accessory protein beta,
• Gene location: 3q28 (27022521: 27030672)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differ
• OMIM: 602626

Protein Summary

• Protein general information: Q9NPH3  
  • Name: Interleukin 1 receptor accessory protein (IL 1 receptor accessory protein) (IL 1RAcP) (EC 3.2.2.6) (Interleukin 1 receptor 3) (IL 1R 3) (IL 1R3)
  • Length: 570  
  • Mass: 65418
  • Tissue specificity: Detected in liver, skin, placenta, thymus and lung. Isoform 4 is predominantly expressed in brain. Overexpressed on candidate chronic myeloid leukemia (CML) stem cells, hematopoietic stem cells and mononuclear cells of patients with ac
• Sequence:

  MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQ
  DRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLY
  IEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHL
  TRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
  SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATVLLVVILI
  VVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIV
  TDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIK
  WKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQGLSYSSLKNV

• Structural information:
  • Protein Domains: (21..12-)
    1 (/note="Ig-like-C2-type)
    (141..23-)
    2 (/note="Ig-like-C2-type)
    (242..34-)
    3 (/note="Ig-like-C2-type)
    (403..54-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR041416  IPR003599   IPR015621  IPR004074  IPR000157  IPR035897  
  • Prosite: PS50835 PS50104
  • PDB: 3O4O 4DEP
  • PDBsum: 3O4O 4DEP
  • DIP: 33487
• Other Databases: GeneCards:  IL1RAP  Malacards:  IL1RAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005149	interleukin-1 receptor binding	IBA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0004908	interleukin-1 receptor activity	IBA	molecular function
GO:0051965	positive regulation of synapse assembly	ISS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004908	interleukin-1 receptor activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA	molecular function
GO:0050135	NAD(P)+ nucleosidase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038172	interleukin-33-mediated signaling pathway	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0038172	interleukin-33-mediated signaling pathway	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0002114	interleukin-33 receptor activity	IEA	molecular function
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0099545	trans-synaptic signaling by trans-synaptic complex	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0072602	interleukin-4 secretion	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0042094	interleukin-2 biosynthetic process	IEA	biological process
GO:0032754	positive regulation of interleukin-5 production	IEA	biological process
GO:0032736	positive regulation of interleukin-13 production	IEA	biological process
GO:0004908	interleukin-1 receptor activity	IEA	molecular function
GO:2000778	positive regulation of interleukin-6 secretion	IEA	biological process
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0099151	regulation of postsynaptic density assembly	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04659	Th17 cell differentiation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881