• Gene id: 3553

Gene Summary

• Gene Symbol: IL1B   Gene   UCSC   Ensembl
• Aliases: IL-1, IL1-BETA, IL1F2
• Gene name: interleukin 1 beta
• Alternate names: interleukin-1 beta, IL-1 beta, catabolin, preinterleukin 1 beta, pro-interleukin-1-beta,
• Gene location: 2q14.1 (112836842: 112829757)     Exons: 7     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an impo
• OMIM: 147720

Protein Summary

• Protein general information: P01584  
  • Name: Interleukin 1 beta (IL 1 beta) (Catabolin)
  • Length: 269  
  • Mass: 30,748
• Sequence:

  MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLR
  KMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQ
  DMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNK
  LEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

• Structural information:
  • Interpro: IPR003296  IPR020877  IPR000975  IPR003502  IPR008996  
  • Prosite: PS00253
  • PDB: 1HIB 1I1B 1IOB 1ITB 1L2H 1S0L 1T4Q 1TOO 1TP0 1TWE 1TWM 21BI 2I1B 2KH2 2NVH 31BI 3LTQ 3O4O 3POK 41BI 4DEP 4G6J 4G6M 4GAF 4GAI 4I1B 5BVP 5I1B 5MVZ 6I1B 7I1B 9ILB
  • PDBsum: 1HIB 1I1B 1IOB 1ITB 1L2H 1S0L 1T4Q 1TOO 1TP0 1TWE 1TWM 21BI 2I1B 2KH2 2NVH 31BI 3LTQ 3O4O 3POK 41BI 4DEP 4G6J 4G6M 4GAF 4GAI 4I1B 5BVP 5I1B 5MVZ 6I1B 7I1B 9ILB
  • DIP: 474
  • STRING: ENSP00000263341
• Other Databases: GeneCards:  IL1B  Malacards:  IL1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0001660	fever generation	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	NAS	biological process
GO:0002439	chronic inflammatory response to antigenic stimulus	IEA	biological process
GO:0002711	positive regulation of T cell mediated immunity	IC	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0005125	cytokine activity	IMP	molecular function
GO:0005149	interleukin-1 receptor binding	IBA	molecular function
GO:0005149	interleukin-1 receptor binding	NAS	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IMP	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006144	purine nucleobase metabolic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007566	embryo implantation	TAS	biological process
GO:0007568	aging	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008210	estrogen metabolic process	IEA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009100	glycoprotein metabolic process	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0010193	response to ozone	IEA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	ISS	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010829	negative regulation of glucose transport	ISS	biological process
GO:0014050	negative regulation of glutamate secretion	IEA	biological process
GO:0014805	smooth muscle adaptation	NAS	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019742	pentacyclic triterpenoid metabolic process	IEA	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0030213	hyaluronan biosynthetic process	IDA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0030638	polyketide metabolic process	IEA	biological process
GO:0030728	ovulation	IEA	biological process
GO:0030730	sequestering of triglyceride	IDA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IC	biological process
GO:0031622	positive regulation of fever generation	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032308	positive regulation of prostaglandin secretion	ISS	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032611	interleukin-1 beta production	IEA	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	TAS	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0033092	positive regulation of immature T cell proliferation in thymus	IEA	biological process
GO:0033129	positive regulation of histone phosphorylation	NAS	biological process
GO:0033198	response to ATP	IEA	biological process
GO:0033280	response to vitamin D	IEA	biological process
GO:0033591	response to L-ascorbic acid	IEA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	NAS	biological process
GO:0035066	positive regulation of histone acetylation	NAS	biological process
GO:0035176	social behavior	IEA	biological process
GO:0035234	ectopic germ cell programmed cell death	IEA	biological process
GO:0035505	positive regulation of myosin light chain kinase activity	IDA	biological process
GO:0035634	response to stilbenoid	IEA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0036270	response to diuretic	IEA	biological process
GO:0036273	response to statin	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0043407	negative regulation of MAP kinase activity	ISS	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0045080	positive regulation of chemokine biosynthetic process	IEA	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IMP	biological process
GO:0045410	positive regulation of interleukin-6 biosynthetic process	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0045766	positive regulation of angiogenesis	ISS	biological process
GO:0045833	negative regulation of lipid metabolic process	ISS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0046827	positive regulation of protein export from nucleus	NAS	biological process
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IMP	biological process
GO:0050796	regulation of insulin secretion	IDA	biological process
GO:0050995	negative regulation of lipid catabolic process	IDA	biological process
GO:0050996	positive regulation of lipid catabolic process	ISS	biological process
GO:0050999	regulation of nitric-oxide synthase activity	IDA	biological process
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0060355	positive regulation of cell adhesion molecule production	NAS	biological process
GO:0060559	positive regulation of calcidiol 1-monooxygenase activity	IDA	biological process
GO:0060559	positive regulation of calcidiol 1-monooxygenase activity	IDA	biological process
GO:0070062	extracellular exosome	IEA	cellular component
GO:0070164	negative regulation of adiponectin secretion	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070487	monocyte aggregation	IDA	biological process
GO:0071236	cellular response to antibiotic	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071310	cellular response to organic substance	IDA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071398	cellular response to fatty acid	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0071414	cellular response to methotrexate	IEA	biological process
GO:0071548	response to dexamethasone	IEA	biological process
GO:0071639	positive regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:1903140	regulation of establishment of endothelial barrier	IDA	biological process
GO:2000173	negative regulation of branching morphogenesis of a nerve	IEA	biological process
GO:2000178	negative regulation of neural precursor cell proliferation	IEA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IEA	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0001660	fever generation	IEA	biological process
GO:0001660	fever generation	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	NAS	biological process
GO:0002439	chronic inflammatory response to antigenic stimulus	IEA	biological process
GO:0002711	positive regulation of T cell mediated immunity	IC	biological process
GO:0005102	receptor binding	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005125	cytokine activity	IMP	molecular function
GO:0005149	interleukin-1 receptor binding	IEA	molecular function
GO:0005149	interleukin-1 receptor binding	IBA	molecular function
GO:0005149	interleukin-1 receptor binding	NAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IMP	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006144	purine nucleobase metabolic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007566	embryo implantation	TAS	biological process
GO:0007568	aging	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008210	estrogen metabolic process	IEA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009100	glycoprotein metabolic process	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0009743	response to carbohydrate	IEA	biological process
GO:0010193	response to ozone	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IEA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	ISS	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IDA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0010829	negative regulation of glucose transport	IEA	biological process
GO:0010829	negative regulation of glucose transport	ISS	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0014050	negative regulation of glutamate secretion	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0014805	smooth muscle adaptation	NAS	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019742	pentacyclic triterpenoid metabolic process	IEA	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0030213	hyaluronan biosynthetic process	IDA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0030638	polyketide metabolic process	IEA	biological process
GO:0030728	ovulation	IEA	biological process
GO:0030730	sequestering of triglyceride	IDA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IC	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031622	positive regulation of fever generation	IEA	biological process
GO:0031622	positive regulation of fever generation	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0031982	vesicle	IEA	cellular component
GO:0032308	positive regulation of prostaglandin secretion	IEA	biological process
GO:0032308	positive regulation of prostaglandin secretion	ISS	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032611	interleukin-1 beta production	IEA	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	TAS	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IEA	biological process
GO:0033092	positive regulation of immature T cell proliferation in thymus	IEA	biological process
GO:0033129	positive regulation of histone phosphorylation	NAS	biological process
GO:0033198	response to ATP	IEA	biological process
GO:0033280	response to vitamin D	IEA	biological process
GO:0033591	response to L-ascorbic acid	IEA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	NAS	biological process
GO:0035066	positive regulation of histone acetylation	NAS	biological process
GO:0035176	social behavior	IEA	biological process
GO:0035234	ectopic germ cell programmed cell death	IEA	biological process
GO:0035505	positive regulation of myosin light chain kinase activity	IDA	biological process
GO:0035634	response to stilbenoid	IEA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0036270	response to diuretic	IEA	biological process
GO:0036273	response to statin	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0043407	negative regulation of MAP kinase activity	ISS	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0045080	positive regulation of chemokine biosynthetic process	IEA	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IMP	biological process
GO:0045410	positive regulation of interleukin-6 biosynthetic process	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0045687	positive regulation of glial cell differentiation	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045766	positive regulation of angiogenesis	ISS	biological process
GO:0045833	negative regulation of lipid metabolic process	IEA	biological process
GO:0045833	negative regulation of lipid metabolic process	ISS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0046827	positive regulation of protein export from nucleus	NAS	biological process
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IMP	biological process
GO:0050768	negative regulation of neurogenesis	IEA	biological process
GO:0050796	regulation of insulin secretion	IDA	biological process
GO:0050900	leukocyte migration	IEA	biological process
GO:0050995	negative regulation of lipid catabolic process	IDA	biological process
GO:0050996	positive regulation of lipid catabolic process	IEA	biological process
GO:0050996	positive regulation of lipid catabolic process	ISS	biological process
GO:0050999	regulation of nitric-oxide synthase activity	IEA	biological process
GO:0050999	regulation of nitric-oxide synthase activity	IDA	biological process
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0060355	positive regulation of cell adhesion molecule production	NAS	biological process
GO:0060559	positive regulation of calcidiol 1-monooxygenase activity	IDA	biological process
GO:0060559	positive regulation of calcidiol 1-monooxygenase activity	IDA	biological process
GO:0070062	extracellular exosome	IEA	cellular component
GO:0070164	negative regulation of adiponectin secretion	IEA	biological process
GO:0070164	negative regulation of adiponectin secretion	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070487	monocyte aggregation	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071236	cellular response to antibiotic	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071310	cellular response to organic substance	IDA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071396	cellular response to lipid	IEA	biological process
GO:0071398	cellular response to fatty acid	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0071414	cellular response to methotrexate	IEA	biological process
GO:0071548	response to dexamethasone	IEA	biological process
GO:0071639	positive regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:1903140	regulation of establishment of endothelial barrier	IDA	biological process
GO:2000173	negative regulation of branching morphogenesis of a nerve	IEA	biological process
GO:2000178	negative regulation of neural precursor cell proliferation	IEA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IEA	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	NAS	biological process
GO:0002711	positive regulation of T cell mediated immunity	IC	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0005125	cytokine activity	IMP	molecular function
GO:0005149	interleukin-1 receptor binding	IBA	molecular function
GO:0005149	interleukin-1 receptor binding	NAS	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IMP	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007566	embryo implantation	TAS	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	ISS	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010829	negative regulation of glucose transport	ISS	biological process
GO:0014805	smooth muscle adaptation	NAS	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0030213	hyaluronan biosynthetic process	IDA	biological process
GO:0030730	sequestering of triglyceride	IDA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IC	biological process
GO:0031622	positive regulation of fever generation	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032308	positive regulation of prostaglandin secretion	ISS	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	TAS	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0033129	positive regulation of histone phosphorylation	NAS	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	NAS	biological process
GO:0035066	positive regulation of histone acetylation	NAS	biological process
GO:0035505	positive regulation of myosin light chain kinase activity	IDA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043407	negative regulation of MAP kinase activity	ISS	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IMP	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0045766	positive regulation of angiogenesis	ISS	biological process
GO:0045833	negative regulation of lipid metabolic process	ISS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0046827	positive regulation of protein export from nucleus	NAS	biological process
GO:0050766	positive regulation of phagocytosis	IMP	biological process
GO:0050796	regulation of insulin secretion	IDA	biological process
GO:0050995	negative regulation of lipid catabolic process	IDA	biological process
GO:0050996	positive regulation of lipid catabolic process	ISS	biological process
GO:0050999	regulation of nitric-oxide synthase activity	IDA	biological process
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0060355	positive regulation of cell adhesion molecule production	NAS	biological process
GO:0060559	positive regulation of calcidiol 1-monooxygenase activity	IDA	biological process
GO:0060559	positive regulation of calcidiol 1-monooxygenase activity	IDA	biological process
GO:0070164	negative regulation of adiponectin secretion	ISS	biological process
GO:0070487	monocyte aggregation	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071310	cellular response to organic substance	IDA	biological process
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0071639	positive regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:1903140	regulation of establishment of endothelial barrier	IDA	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04217	Necroptosis
hsa04640	Hematopoietic cell lineage
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04380	Osteoclast differentiation
hsa05323	Rheumatoid arthritis
hsa05321	Inflammatory bowel disease
hsa05332	Graft-versus-host disease
hsa05010	Alzheimer disease
hsa05020	Prion diseases
hsa05418	Fluid shear stress and atherosclerosis
hsa04940	Type I diabetes mellitus
hsa04932	Non-alcoholic fatty liver disease
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05134	Legionellosis
hsa05152	Tuberculosis
hsa05162	Measles
hsa05164	Influenza A
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05146	Amoebiasis
hsa05144	Malaria
hsa05140	Leishmaniasis
hsa05142	Chagas disease
hsa05143	African trypanosomiasis
hsa01523	Antifolate resistance

Diseases

Associated diseases	References
Cancer (nasopharyngeal)	GAD: 18289837
Cancer (noncardia gastric)	GAD: 14753224
Cancer (non-Hodgkin lymphoma)	GAD: 16389181
Cancer (non-melanoma skin cancer)	GAD: 15914210
Cancer (ovarian)	GAD: 15581980
Cancer (pancreatic)	GAD: 11076651
Cancer (prostate)	GAD: 12067976
Cancer (Squamous cell)	GAD: 19495883
Cancer (stomach)	GAD: 15579481
Cancer (uterine cervical)	GAD: 18154955
Cancer (vulvar)	GAD: 14984963
Cancer	GAD: 12500190
Cancer (Adenocarcinoma)	GAD: 19692203
Cancer (basal cell)	GAD: 17107380
Cancer (Biliary tract neoplasms)	GAD: 18676870
Cancer (bladder)	GAD: 16938461
Cancer (cervical)	GAD: 18333945
Cancer (colon)	GAD: 18987561
Cancer (colorectal)	GAD: 17454884
Cancer (esophageal)	GAD: 18396210
Cancer (gastric)	GAD: 12133467
Cancer (glaucoma)	GAD: 17460270
Cancer (Hepatocellular)	GAD: 12500190
Cancer (laryngeal)	GAD: 17356794
Cancer (leiomyoma)	GAD: 17222831
Cancer (leukemia)	GAD: 19074885
Cancer (liver)	GAD: 16172101
Cancer (lung)	GAD: 14961572
Cancer (lymphoma)	GAD: 15146559
Cancer (melanoma)	GAD: 14675394
Cancer (mouth)	GAD: 15900573
Cancer (myeloma)	GAD: 18997828
Cancer (breast)	GAD: 15265021
Aneurysm	GAD: 12756345
Apoplexy	GAD: 20536609
Atherosclerosis	GAD: 12958619
Atherosclerosis	GAD: 12899665
Brain ischemia	GAD: 19028820
Cardiovascular disease	GAD: 11975906
Cerebral hemorrhage	GAD: 19092239
Cerebral infarction	GAD: 12901853
Myocardial Infarction	GAD: 19811432
Hypercholesterolemia	GAD: 20602615
Hypertension	GAD: 12009575
Cardiovascular disease	GAD: 12082592
Peripheral vascular disease	GAD: 16541711
Restenosis	GAD: 12082592
Thromboembolism	GAD: 17413037
Fabry disease	GAD: 17353161
Cystic fibrosis	GAD: 19009622
Gastric disease	GAD: 19295440
Primary biliary cirrhosis	GAD: 15562761
Thyroid diseases	GAD: 15372364
Hashimoto disease	GAD: 17115419
Graves disease	GAD: 19793334
Graves ophthalmopathy	GAD: 19702713
Choroidal neovascularization	GAD: 18235016
Keratoconus	GAD: 19043479
Primary open-angle glaucoma	GAD: 12913327
Macular degeneration	GAD: 18310311
Retinopathy	GAD: 18787502
Pterygium	GAD: 15184943
Anemia	GAD: 18781863
Blood coagulation disorders	GAD: 20417488
Sarcoidosis	GAD: 12039524
Hemophilia	GAD: 16380445
Henoch-Schonlein purpura	GAD: 14760799
Chronic immune thrombocytopenic purpura	GAD: 15009068
Hodgkin disease	GAD: 21061265
Idiopathic thrombocytopenic purpura	GAD: 20626741
Kawasaki disease	GAD: 15900570
Aggressive periodontitis	GAD: 18723088
Alopecia areata	GAD: 11703512
Ankylosing spondylitis	GAD: 16206345
Arthritis	GAD: 11981324
Asthma	GAD: 11027520
Asthma	GAD: 11739132
Atopy	GAD: 12746420
Autoimmune diseases	GAD: 17964974
Behcet's disease	GAD: 17960403
Bullous pemphigoid	GAD: 16403098
Inflammation	GAD: 18369665
Ulcerative colitis	GAD: 19392835
Celiac disease	GAD: 16078996
Chronic ulcerative colitis	GAD: 20509889
Crohn's disease	GAD: 18942754
Crohn's disease	GAD: 11686217
Ulcerative colitis	GAD: 12572877
Rheumatoid arthritis	GAD: 15895884
Multiple sclerosis	GAD: 11498264
Periodontitis	GAD: 16304445
Psoriasis	GAD: 17388919
Psoriatic arthritis	GAD: 16918024
Scleroderma	GAD: 20603050
Systemic lupus erythematosus (SLE)	GAD: 11958432
Systemic lupus erythematosus (SLE)	GAD: 17335370
Systemic lupus erythematosus (SLE)	GAD: 15088297
Juvenile arthritis	GAD: 15170937
Inflammatory bowel disease	GAD: 9568467
Hypersensitivity	GAD: 15658613
Amyloidosis	GAD: 19026124
Biliary atresia	GAD: 12100571
Biliary cirrhosis	GAD: 15884119
Diabetes	GAD: 12418458
Fatty liver	GAD: 15318095
Metabolic syndrome	GAD: 18716798
Obesity	GAD: 18465425
Achondroplasia	GAD: 12105837
Bone diseases	GAD: 16520888
Degenerative arthropathy	GAD: 20237151
Osteoarthritis	GAD: 11083263
Osteolysis	GAD: 18821666
Knee osteoarthritis	GAD: 19934104
Spinal diseases	GAD: 18469698
Ankylosing spondylitis	GAD: 18484691
Dermatomyositis	GAD: 19035492
Rheumatic diseases	GAD: 17763205
Febrile seizures	GAD: 19854014
Temporal lobe epilepsy	GAD: 14510824
Migraine disorder	GAD: 19559392
Febrile Seizures	GAD: 19135625
Stroke	GAD: 16324093
Subarachnoid hemorrhage	GAD: 15726267
Alzheimer's disease	GAD: 16930778
Brain edema	GAD: 16217062
Brain injuries	GAD: 17140155
Epilepsy	GAD: 11422336
Parkinson disease	GAD: 15279067
Acute pancreatitis	GAD: 19220961
Cerebral palsy	GAD: 19238444
Bipolar disorder	GAD: 19125864
Bulimia	GAD: 20468064
Cognitive function	GAD: 19013689
Dementia	GAD: 19546559
Depression	GAD: 18728809
Dyspepsia	GAD: 20890567
Dysthymia	GAD: 14997019
Mood disorders	GAD: 18832862
Psychological disorders	GAD: 18728809
Schizophrenia	GAD: 14563376
Albuminuria	GAD: 21054877
Chronic renal failure	GAD: 20551628
Abortion	GAD: 20587610
Azoospermia	GAD: 20378615
Chorioamnionitis	GAD: 20452482
Preeclampsia	GAD: 12044341
Recurrent pregnancy loss (RPL)	GAD: 11756575
Premature birth	GAD: 19141488
Recurrent pregnancy loss (RPL)	GAD: 11857060
Preterm birth risk	GAD: 15951664
Pelvic adhesions	INFBASE: 11756364
Adenomyosis	INFBASE: 12069392
Disorders of the endometrium	INFBASE: 16264101
Implantation failure	INFBASE: 16264101
Endometriosis	INFBASE: 23269356
Female infertility	INFBASE: 8607944
Endometriosis-associated infertility	INFBASE: 17919610
Implantation failure	INFBASE: 16274610
Female infertility	INFBASE: 16433835
Genital endometriosis	INFBASE: 16758620
Female infertility	INFBASE: 8723440
Recurrent implantation failure (RIF)	INFBASE: 12615834
External gential endometriosis	INFBASE: 16027877
Leiomyoma	INFBASE: 14597251
Polycystic ovary syndrome (PCOS)	INFBASE: 24576416
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 9093211
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 8671471
Ovarian dysfunction	INFBASE: 16579166
Tubal factor infertility	INFBASE: 22007253
Asthenozoospermia	MIK: 24981555
Male factor infertility	MIK: 24981555
Oligoasthenoteratozoospermia	MIK: 17335817
Male factor infertility	MIK: 17215863
Male factor infertility	MIK: 20576636
Sperm motility	MIK: 8723440
Male factor infertility	MIK: 7928663
Sertoli cell only syndrome (SCOS)	MIK: 20188355
Male factor infertility	MIK: 8723440
Spermatogenesis defects	MIK: 23869807
Sertoli cell only syndrome (SCOS)	MIK: 21235388
Oligozoospermia	MIK: 17341438
Impaired human spermatogenesis	MIK: 17215863
Implantation failure	INFBASE: 12615834
Incomplete maturation arrest (IMA)	INFBASE: 21235388
Hypospermatogenesis	MIK: 20188355
Asthenozoospermia	MIK: 17341438
Female infertility	INFBASE: 23116196
Germ cell arrest	MIK: 20188355
Chronic obstructive pulmonary disease (COPD)	GAD: 18364273
Silicosis	GAD: 11241561
Lung disease	GAD: 18545091
Pulmonary fibrosis	GAD: 16573560
Obstructive sleep apnea	GAD: 19218687
Rhinitis	GAD: 14533660
Dermatitis	GAD: 13679820
Erythema	GAD: 12626603
Systemic sclerosis	KEGG: H01492
Pemphigus vulgaris	GAD: 19470040
Connective tissue diseases	GAD: 19527514
Chronic periodontitis	GAD: 18673406
Early onset periodontitis	GAD: 11350506
Periapical periodontitis	GAD: 19720214
Periodontal disease	GAD: 15341923
Gingivitis	GAD: 12622850
Adult onset still's disease	GAD: 17963170
Alveolar Bone Loss	GAD: 12558933
Asphyxia neonatorum	GAD: 16181755
Atrophy	GAD: 19448967
Duodenal ulcer	GAD: 19804405
Ischemia	GAD: 14707339
Thryoiditis	GAD: 11506478
Spinal ossification	GAD: 12195069
Cachexia	GAD: 19244371
Nephrolithiasis	GAD: 17258699
Nephropathy	GAD: 11849463
Urolithiasis	GAD: 18186699
Uterine diseases	GAD: 18930197
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 24981555
Hypospermatogenesis	MIK: 20188355
Germ cell arrest	MIK: 20188355
Sertoli cell-only syndrome	MIK: 20188355
Incomplete maturation arrest (IMA)	MIK: 21235388
Male infertility	MIK: 8723440
Oligozoospermia	MIK: 17341438
Spermatogenic defects	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
7928663	Male infertility			26 (15 infertile men, 10 fertile men)	Male infertility	TNF-alpha IFN-gamma IL-1 beta IL-7
26648778	Male infertility			82 (27 healthy controls, 55 infertile patients (22 patients with varicocele, 13 with idiopathic infertility) )	Male infertility	IL-1? IL-10 IL-18 TGF-?1 IFN-g IL-6
20576636	Infertility			96 (male infertility, n = 61; female infertility factors, n = 35)	Male infertility, Female infertility
17341438	Oligozoospermia, asthenozoospermia			62 (34 controls, 28 men with oligozoospermia or asthenozoospermia)	Male infertility	IL-6 IL-8 VEGF TNFalpha IL-1beta TGFbeta1 and G-CSF
15595690	Male infertility			146 (126 infertile males, 20 males)	Male infertility	IL1b IL4 IL10
24981555	Asthenozoospermia			51 (28 infertile patients with asthenozoospermia, 23 normospermic fertile donors )	Male infertility	IL-1? COX-2 and HIF-1?
17215863	Impaired human spermatogenesis				Male infertility
24067094	Male infertility	C?+?3953T gene polymorphism		452 (222 infertile patients, 230 fertile healthy control men)	Male infertility
23869807	Spermatogenic defects			20 (16 non-obstructive azoospermia (NOA), 4 normal spermatogenesis)	Male infertility	IL-6 IL-10 TNF family SCF and c-kit
17430733	Male infertility			148 asymptomatic males from subfertile couples	Male infertility	TNF-alpha IL-1beta
23869807	Spermatogenic defects			20 (16 patients with various types of NOA, 4 with normal spermatogenesis)	Male infertility	IL1-R1 CASP1 SCF IL1-RA
21235388	Incomplete maturation arrest (IMA), Sertoli only syndrome (SOS)				Male infertility	IL-? IL-1ra
20188355	Hypospermatogenesis, germ cell arrest or Sertoli cell-only syndrome				Male infertility	COX-2 IL- 1beta
9262280	Male infertility			140 (21 fertile subjects, 119 patients with a range of andrological diseases)	Male infertility	IL-beta IL-2 IL-6 sR IL-2 SR IL-6
8723440	Sperm motility, male infertility			22 (14 infertile males, 8 healthy control subjects)	Male infertility	IL-1 IL-6 TNF alpha
11868623	Male infertility			71 (66 subfertile subjects (22 patients with varicocele, 14 with infection of accessory genital glands, 4 varicocele plus infection, 8 chronic epididymitis, 5 post-renal transplantation status, 9 idiopathic oligoasthenoteratospermia, 1 cryptorchidism, 3 h	Male infertility	IL-1beta TNF-alpha
17335817	Associated with sperm pathology		Caucasi ans	562 (127 normozoospermic and 435 non-normozoospermic men)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881