Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 3552
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol IL1A   Gene   UCSC   Ensembl
Aliases IL-1A, IL1, IL1-ALPHA, IL1F1
Gene name interleukin 1 alpha
Alternate names interleukin-1 alpha, IL-1 alpha, hematopoietin-1, preinterleukin 1 alpha, pro-interleukin-1-alpha,
Gene location 2q14.1 (112785397: 112773914)     Exons: 7     NC_000002.12
Gene summary(Entrez) The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macropha
OMIM 147760

Protein Summary
Protein general information P01583  

Name: Interleukin 1 alpha (IL 1 alpha) (Hematopoietin 1)

Length: 271  Mass: 30,607

Sequence MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVA
TNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQ
YLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFW
ETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Structural information
Interpro:  IPR003295  IPR020877  IPR000975  IPR003502  IPR008996  
Prosite:   PS00253

PDB:  		 1ITA 2ILA 2KKI 2L5X 5UC6
PDBsum:   1ITA 2ILA 2KKI 2L5X 5UC6

DIP:  
40550
STRING:   ENSP00000263339
Other Databases GeneCards:  IL1A  Malacards:  IL1A

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0001660 fever generation
 IEA biological process
GO:0002248 connective tissue replace
ment involved in inflamma
tory response wound heali
ng
 IEA biological process
GO:0005125 cytokine activity
 IMP molecular function
GO:0005149 interleukin-1 receptor bi
nding
 IBA molecular function
GO:0005507 copper ion binding
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 IMP cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0006915 apoptotic process
 TAS biological process
GO:0006954 inflammatory response
 TAS biological process
GO:0006955 immune response
 IEA biological process
GO:0008283 cell proliferation
 TAS biological process
GO:0008285 negative regulation of ce
ll proliferation
 IDA biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
 ISS biological process
GO:0010628 positive regulation of ge
ne expression
 IDA biological process
GO:0019221 cytokine-mediated signali
ng pathway
 IMP biological process
GO:0034605 cellular response to heat
 IDA biological process
GO:0035234 ectopic germ cell program
med cell death
 IEA biological process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IBA biological process
GO:0045086 positive regulation of in
terleukin-2 biosynthetic
process
 IMP biological process
GO:0045766 positive regulation of an
giogenesis
 ISS biological process
GO:0045840 positive regulation of mi
totic nuclear division
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological process
GO:0046330 positive regulation of JN
K cascade
 IBA biological process
GO:0046688 response to copper ion
 IDA biological process
GO:0050714 positive regulation of pr
otein secretion
 IMP biological process
GO:0050715 positive regulation of cy
tokine secretion
 IDA biological process
GO:0097192 extrinsic apoptotic signa
ling pathway in absence o
f ligand
 IEA biological process
GO:2001240 negative regulation of ex
trinsic apoptotic signali
ng pathway in absence of
ligand
 TAS biological process
GO:0001660 fever generation
 IEA biological process
GO:0002248 connective tissue replace
ment involved in inflamma
tory response wound heali
ng
 IEA biological process
GO:0005125 cytokine activity
 IEA molecular function
GO:0005125 cytokine activity
 TAS molecular function
GO:0005125 cytokine activity
 IMP molecular function
GO:0005149 interleukin-1 receptor bi
nding
 IEA molecular function
GO:0005149 interleukin-1 receptor bi
nding
 IBA molecular function
GO:0005507 copper ion binding
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005576 extracellular region
 IEA cellular component
GO:0005576 extracellular region
 IEA cellular component
GO:0005576 extracellular region
 IEA cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005615 extracellular space
 IEA cellular component
GO:0005615 extracellular space
 IEA cellular component
GO:0005615 extracellular space
 IEA cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 TAS cellular component
GO:0005615 extracellular space
 IMP cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0006915 apoptotic process
 TAS biological process
GO:0006954 inflammatory response
 IEA biological process
GO:0006954 inflammatory response
 IEA biological process
GO:0006954 inflammatory response
 TAS biological process
GO:0006955 immune response
 IEA biological process
GO:0008283 cell proliferation
 TAS biological process
GO:0008285 negative regulation of ce
ll proliferation
 IDA biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
 IEA biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
 ISS biological process
GO:0010628 positive regulation of ge
ne expression
 IDA biological process
GO:0019221 cytokine-mediated signali
ng pathway
 IMP biological process
GO:0034605 cellular response to heat
 IDA biological process
GO:0035234 ectopic germ cell program
med cell death
 IEA biological process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IBA biological process
GO:0045086 positive regulation of in
terleukin-2 biosynthetic
process
 IMP biological process
GO:0045766 positive regulation of an
giogenesis
 IEA biological process
GO:0045766 positive regulation of an
giogenesis
 ISS biological process
GO:0045840 positive regulation of mi
totic nuclear division
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological process
GO:0046330 positive regulation of JN
K cascade
 IBA biological process
GO:0046688 response to copper ion
 IDA biological process
GO:0050714 positive regulation of pr
otein secretion
 IMP biological process
GO:0050715 positive regulation of cy
tokine secretion
 IDA biological process
GO:0051781 positive regulation of ce
ll division
 IEA biological process
GO:0097192 extrinsic apoptotic signa
ling pathway in absence o
f ligand
 IEA biological process
GO:2001240 negative regulation of ex
trinsic apoptotic signali
ng pathway in absence of
ligand
 TAS biological process
GO:0005125 cytokine activity
 TAS molecular function
GO:0005125 cytokine activity
 IMP molecular function
GO:0005149 interleukin-1 receptor bi
nding
 IBA molecular function
GO:0005507 copper ion binding
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005615 extracellular space
 IDA cellular component
GO:0005615 extracellular space
 TAS cellular component
GO:0005615 extracellular space
 IMP cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0006915 apoptotic process
 TAS biological process
GO:0006954 inflammatory response
 TAS biological process
GO:0008283 cell proliferation
 TAS biological process
GO:0008285 negative regulation of ce
ll proliferation
 IDA biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
 ISS biological process
GO:0010628 positive regulation of ge
ne expression
 IDA biological process
GO:0019221 cytokine-mediated signali
ng pathway
 IMP biological process
GO:0034605 cellular response to heat
 IDA biological process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IBA biological process
GO:0045086 positive regulation of in
terleukin-2 biosynthetic
process
 IMP biological process
GO:0045766 positive regulation of an
giogenesis
 ISS biological process
GO:0045840 positive regulation of mi
totic nuclear division
 IMP biological process
GO:0046330 positive regulation of JN
K cascade
 IBA biological process
GO:0046688 response to copper ion
 IDA biological process
GO:0050714 positive regulation of pr
otein secretion
 IMP biological process
GO:0050715 positive regulation of cy
tokine secretion
 IDA biological process
GO:2001240 negative regulation of ex
trinsic apoptotic signali
ng pathway in absence of
ligand
 TAS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04060Cytokine-cytokine receptor interaction
hsa04217Necroptosis
hsa04218Cellular senescence
hsa04640Hematopoietic cell lineage
hsa04380Osteoclast differentiation
hsa05323Rheumatoid arthritis
hsa05321Inflammatory bowel disease
hsa05332Graft-versus-host disease
hsa05020Prion diseases
hsa05418Fluid shear stress and atherosclerosis
hsa04940Type I diabetes mellitus
hsa04932Non-alcoholic fatty liver disease
hsa04933AGE-RAGE signaling pathway in diabetic complications
hsa05132Salmonella infection
hsa05133Pertussis
hsa05152Tuberculosis
hsa05162Measles
hsa05164Influenza A
hsa05140Leishmaniasis

Diseases

Expand All | Collapse All
Associated diseases References
Cancer (ovarian) GAD: 15581980
Cancer (prostate) GAD: 19099590
Cancer (Renal cell) GAD: 19658300
Cancer (Squamous cell) GAD: 20133197
Cancer (stomach) GAD: 16885196
Cancer (vulvar) GAD: 14984963
Cancer GAD: 19917630
Cancer (Adenocarcinoma) GAD: 18628242
Cancer (Biliary tract neoplasms) GAD: 18676870
Cancer (bladder) GAD: 16938461
Cancer (cervical) GAD: 19012493
Cancer (colorectal) GAD: 18510611
Cancer (esophageal) GAD: 20453000
Cancer (gastric) GAD: 19013788
Cancer (glaucoma) GAD: 17460270
Cancer (Hepatocellular) GAD: 19917630
Cancer (leukemia) GAD: 19074885
Cancer (lung) GAD: 18676680
Cancer (lymphoma) GAD: 18038187
Cancer (myeloma) GAD: 20568250
Cancer (non-Hodgkin lymphoma) GAD: 16389181
Cancer (breast) GAD: 16464738
Aneurysm GAD: 16268484
Angina pectoris GAD: 18157711
Apoplexy GAD: 20536609
Atherosclerosis GAD: 12899665
Atrial fibrillation GAD: 20490891
Cardiovascular disease GAD: 11887471
Cerebral amyloid angiopathy (CAA) GAD: 12947160
Cerebral infarction GAD: 12824054
Hypertension GAD: 15476179
Myocardial Infarction GAD: 19811432
Brain ischemia GAD: 19028820
Restenosis GAD: 12082592
Fabry disease GAD: 17353161
Cystic fibrosis GAD: 19431193
Irritable bowel syndrome GAD: 19844779
Graves disease GAD: 8954062
Macular degeneration GAD: 16384981
Retinopathy GAD: 18787502
Keratoconus GAD: 19043479
Sarcoidosis GAD: 12737276
Lymphoproliferative disorders GAD: 18361934
Hodgkin disease GAD: 19573080
Aggressive periodontitis GAD: 12974682
Alopecia areata GAD: 11703512
Ankylosing spondylitis GAD: 16206345
Arthritis GAD: 11981324
Asthma GAD: 18773331
Atopy GAD: 12746420
Autoimmune diseases GAD: 17964974
Behcet's disease GAD: 12730545
Celiac disease GAD: 16078996
Chronic ulcerative colitis GAD: 14735144
Juvenile arthritis GAD: 15170937
Multiple sclerosis GAD: 20192980
Psoriasis GAD: 17388919
Psoriatic arthritis GAD: 16918024
Scleroderma GAD: 20603050
Systemic lupus erythematosus (SLE) GAD: 15219382
Systemic lupus erythematosus (SLE) GAD: 14672899
Bullous pemphigoid GAD: 16403098
Common variable immunodeficiency GAD: 19076825
Biliary atresia GAD: 12100571
Diabetes GAD: 10671304
Hypercholesterolemia GAD: 20602615
Metabolic syndrome GAD: 18716798
Obesity GAD: 18306451
Degenerative arthropathy GAD: 12801479
Osteoarthritis GAD: 15077300
Osteolysis GAD: 18821666
Osteomyelitis GAD: 18971305
Osteoporosis GAD: 20940514
Spinal diseases GAD: 18469698
Ankylosing spondylitis GAD: 18484691
Bone diseases GAD: 17331078
Knee osteoarthritis GAD: 12115182
Dermatomyositis GAD: 19035492
Migraine disorder GAD: 12047332
Migraine disorder GAD: 19559392
Giant cell arteritis GAD: 12102486
Subarachnoid hemorrhage GAD: 15726267
Myasthenia gravis GAD: 11777547
Alzheimer's disease GAD: 16733901
Epilepsy GAD: 19066720
Parkinson disease GAD: 18760325
Brain injuries GAD: 16378839
Dementia GAD: 19546559
Dysthymia GAD: 14997019
Mood disorders GAD: 18832862
Psychological disorders GAD: 19546559
Schizophrenia GAD: 18583979
Chronic renal failure GAD: 20551628
Chorioamnionitis GAD: 20452482
Preeclampsia GAD: 17179726
Premature birth GAD: 19141488
Preterm birth risk GAD: 15951664
Female infertility INFBASE: 25631342
Endometriosis INFBASE: 25336714
Endometrial polyp INFBASE: 15746198
Female infertility INFBASE: 16046047
Oocyte development and maturation INFBASE: 9513849
Polycystic ovary syndrome (PCOS) INFBASE: 19191034
Female infertility INFBASE: 16965825
Asthenozoospermia MIK: 11839394
Leukocytospermia MIK: 11839394
Sperm motility MIK: 1601744
Male factor infertility MIK: 17215863
Spermatogenesis defects MIK: 17215863
Oligozoospermia MIK: 11839394
Spermatogenesis defects MIK: 17215863
Male factor infertility MIK: 1601744
Chronic obstructive pulmonary disease (COPD) GAD: 19625176
Silicosis GAD: 11241561
Interstitial lung diseases GAD: 19117745
Pulmonary fibrosis GAD: 16573560
Rhinitis GAD: 14533660
Dermatitis GAD: 18416755
Erythema GAD: 19225544
Systemic sclerosis KEGG: H01492
Pemphigus vulgaris GAD: 19470040
Connective tissue diseases GAD: 19527514
Chronic periodontitis GAD: 18673406
Early onset periodontitis GAD: 11350506
Periodontal disease GAD: 15341923
Gingivitis GAD: 12622850
Alveolar bone Loss GAD: 19053923
Ischemia GAD: 19786079
Spinal ossification GAD: 12195069
Asthenozoospermia MIK: 11839394
Oligozoospermia MIK: 11839394
Leukocytospermia MIK: 11839394
Male infertility MIK: 29968322
Involved during mitosis and meiosis of spermatogenesis MIK: 10433236
Play a role in physiologic functions of sperm cells MIK: 10856470
Sperm motility MIK: 1601744
Spermatogenesis defects MIK: 17215863
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17215863 Imparied h
uman sperm
atogenesis

Male infertility IL-1alpha
IL-1RA
IL-1
IL-18
 Show abstract
1601744 Sperm moti
lity, Male
infertili
ty

Male infertility
Show abstract
11839394 Asthenozoo
spermia, o
ligozoospe
rmia, leuk
ocytosperm
ia
86 (62 subjects
in the normozo
ospermic group,
24 subjects sh
owing abnormal
sperm parameter
s (azoospermia,
n=5; oligozoos
permia, n=4; as
thenozoospermia
, n=15))
 Male infertility interleukin [IL]-1alpha
IL-2
 IL-4
IL-6
IL-8
tumor necrosis factor-alpha [TNF-alpha]
interferon-gamma
granulocyte colony-stimulating factor [G-CSF]
macrophage CFS [M-CSF]
 Show abstract
10856470 Play a rol
e in physi
ologic fun
ctions of
sperm cell
s
25 (17 fertile
men (donors wit
h proved fertil
ity), 8 oligote
ratoasthenosper
mic infertile m
en)
 Male infertility
Show abstract
10433236 Involved d
uring mito
sis and me
iosis of s
permatogen
esis

Male infertility
Show abstract
29968322 Idiopathic
male infe
rtility
 4845G>T Iranian
 460 (230 infert
ile, 230 health
y men)
 Male infertility
Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract