• Gene id: 3550

Gene Summary

• Gene Symbol: IK   Gene   UCSC   Ensembl
• Aliases: CSA2, RED, RER
• Gene name: IK cytokine
• Alternate names: protein Red, IK cytokine, down-regulator of HLA II, IK factor, RD element, chondrosarcoma-associated protein 2, cytokine IK, prer protein,
• Gene location: 5q31.3 (140647817: 140662479)     Exons: 20     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene was identified by its RED repeat, a stretch of repeated arginine, glutamic acid and aspartic acid residues. The protein localizes to discrete dots within the nucleus, excluding the nucleolus. Its function is unknown. This
• OMIM: 600549

Protein Summary

• Protein general information: Q13123  
  • Name: Protein Red (Cytokine IK) (IK factor) (Protein RER)
  • Length: 557  
  • Mass: 65602
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEMPREYNEDEDPAARRR
  KKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELISTTANYRAVGPTAEADKSAAEKRRQLIQES
  KFLGGDMEHTHLVKGLDFALLQKVRAEIASKEKEEEELMEKPQKETKKDEDPENKIEFKTRLGRNVYRMLFKSKA
  YERNELFLPGRMAYVVDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVISKLTQILSYLRQGTRNKKLKK
  KDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRERDRDRDRERERERDRERERERDRERE
  EEKKRHSYFEKPKVDDEPMDVDKGPGSTKELIKSINEKFAGSAGWEGTESLKKPEDKKQLGDFFGMSNSYAECYP
  ATMDDMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDK
  AELDRQWKKISAIIEKRKKMEADGVEVKRPKY

• Structural information:
  • Interpro: IPR039896  IPR012492  IPR012916  
  • PDB: 5O9Z 6Q8I
  • PDBsum: 5O9Z 6Q8I
  • STRING: ENSP00000396301
• Other Databases: GeneCards:  IK  Malacards:  IK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	colocalizes with
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0034501	protein localization to kinetochore	IMP	biological process
GO:0000228	nuclear chromosome	IMP	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)