• Gene id: 355

Gene Summary

• Gene Symbol: FAS   Gene   UCSC   Ensembl
• Aliases: ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
• Gene name: Fas cell surface death receptor
• Alternate names: tumor necrosis factor receptor superfamily member 6, APO-1 cell surface antigen, CD95 antigen, FASLG receptor, Fas (TNF receptor superfamily, member 6), Fas AMA, TNF receptor superfamily member 6, apoptosis antigen 1, apoptosis signaling receptor FAS, apo,
• Gene location: 10q23.31 (88968428: 89017060)     Exons: 15     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogen
• OMIM: 134637

SNPs

rs1800682

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.88990206A>G
NC_000010.10   g.90749963A>G
NG_009089.2   g.4676A>G
NG_011541.1   g.6185T>C|SEQ=[A/G]|GENE=ACTA2
FAS   355

Protein Summary

• Protein general information: P25445  
  • Name: Tumor necrosis factor receptor superfamily member 6 (Apo 1 antigen) (Apoptosis mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95)
  • Length: 335  
  • Mass: 37,732
  • Tissue specificity: Expressed in liver. {ECO
• Sequence:

  MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTV
  NGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCE
  HGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLS
  DVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
  ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

• Structural information:
  • Protein Domains: Death. (230-314)
  • Interpro: IPR011029  IPR000488  IPR008063  IPR001368  IPR033998   IPR033999  
  • Prosite: PS50017 PS00652 PS50050
  • CDD: cd08316 cd10579
  • PDB: 1BZI 1DDF 2NA7 3EWT 3EZQ 3THM 3TJE
  • PDBsum: 1BZI 1DDF 2NA7 3EWT 3EZQ 3THM 3TJE
  • DIP: 924
  • STRING: ENSP00000347979
• Other Databases: GeneCards:  FAS  Malacards:  FAS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001552	ovarian follicle atresia	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0002377	immunoglobulin production	IEA	biological process
GO:0003014	renal system process	IEA	biological process
GO:0004871	signal transducer activity	TAS	molecular function
GO:0004871	signal transducer activity	TAS	molecular function
GO:0004872	receptor activity	NAS	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006461	protein complex assembly	TAS	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006924	activation-induced cell death of T cells	IEA	biological process
GO:0006925	inflammatory cell apoptotic process	IEA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007420	brain development	IBA	biological process
GO:0007568	aging	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IBA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0019724	B cell mediated immunity	IEA	biological process
GO:0019900	kinase binding	IPI	molecular function
GO:0021537	telencephalon development	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0031104	dendrite regeneration	IEA	biological process
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IDA	cellular component
GO:0032403	protein complex binding	IEA	molecular function
GO:0032464	positive regulation of protein homooligomerization	IEA	biological process
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0042698	ovulation cycle	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	NAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0043009	chordate embryonic development	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0045060	negative thymic T cell selection	IEA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0045619	regulation of lymphocyte differentiation	IEA	biological process
GO:0045637	regulation of myeloid cell differentiation	IEA	biological process
GO:0046898	response to cycloheximide	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048536	spleen development	IEA	biological process
GO:0050869	negative regulation of B cell activation	IEA	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070230	positive regulation of lymphocyte apoptotic process	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0070848	response to growth factor	IEA	biological process
GO:0071234	cellular response to phenylalanine	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071279	cellular response to cobalt ion	IEA	biological process
GO:0071285	cellular response to lithium ion	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0071391	cellular response to estrogen stimulus	IEA	biological process
GO:0071455	cellular response to hyperoxia	IMP	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071464	cellular response to hydrostatic pressure	IEA	biological process
GO:0097049	motor neuron apoptotic process	IEA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097284	hepatocyte apoptotic process	IEA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097421	liver regeneration	IEA	biological process
GO:0097440	apical dendrite	IEA	cellular component
GO:0097527	necroptotic signaling pathway	IMP	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902617	response to fluoride	IEA	biological process
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0001552	ovarian follicle atresia	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0002377	immunoglobulin production	IEA	biological process
GO:0003014	renal system process	IEA	biological process
GO:0004871	signal transducer activity	TAS	molecular function
GO:0004871	signal transducer activity	TAS	molecular function
GO:0004872	receptor activity	TAS	molecular function
GO:0004872	receptor activity	NAS	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006461	protein complex assembly	TAS	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006924	activation-induced cell death of T cells	IEA	biological process
GO:0006925	inflammatory cell apoptotic process	IEA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007420	brain development	IBA	biological process
GO:0007568	aging	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IBA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010035	response to inorganic substance	IEA	biological process
GO:0010467	gene expression	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0019724	B cell mediated immunity	IEA	biological process
GO:0019900	kinase binding	IPI	molecular function
GO:0021537	telencephalon development	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0031104	dendrite regeneration	IEA	biological process
GO:0031264	death-inducing signaling complex	IEA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IEA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IDA	cellular component
GO:0032403	protein complex binding	IEA	molecular function
GO:0032464	positive regulation of protein homooligomerization	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0042698	ovulation cycle	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0042981	regulation of apoptotic process	NAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0043005	neuron projection	IBA	cellular component
GO:0043009	chordate embryonic development	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043029	T cell homeostasis	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0045060	negative thymic T cell selection	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0045619	regulation of lymphocyte differentiation	IEA	biological process
GO:0045637	regulation of myeloid cell differentiation	IEA	biological process
GO:0046898	response to cycloheximide	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048536	spleen development	IEA	biological process
GO:0050869	negative regulation of B cell activation	IEA	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070230	positive regulation of lymphocyte apoptotic process	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0070848	response to growth factor	IEA	biological process
GO:0071234	cellular response to phenylalanine	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071279	cellular response to cobalt ion	IEA	biological process
GO:0071285	cellular response to lithium ion	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071345	cellular response to cytokine stimulus	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0071391	cellular response to estrogen stimulus	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071455	cellular response to hyperoxia	IMP	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071464	cellular response to hydrostatic pressure	IEA	biological process
GO:0097049	motor neuron apoptotic process	IEA	biological process
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097284	hepatocyte apoptotic process	IEA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097421	liver regeneration	IEA	biological process
GO:0097440	apical dendrite	IEA	cellular component
GO:0097527	necroptotic signaling pathway	IEA	biological process
GO:0097527	necroptotic signaling pathway	IMP	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902617	response to fluoride	IEA	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0004871	signal transducer activity	TAS	molecular function
GO:0004871	signal transducer activity	TAS	molecular function
GO:0004872	receptor activity	TAS	molecular function
GO:0004872	receptor activity	NAS	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006461	protein complex assembly	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007420	brain development	IBA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IBA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0019900	kinase binding	IPI	molecular function
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IDA	cellular component
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	NAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071455	cellular response to hyperoxia	IMP	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097527	necroptotic signaling pathway	IMP	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04210	Apoptosis
hsa04217	Necroptosis
hsa04115	p53 signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer
hsa05320	Autoimmune thyroid disease
hsa05330	Allograft rejection
hsa05332	Graft-versus-host disease
hsa05010	Alzheimer disease
hsa04940	Type I diabetes mellitus
hsa04932	Non-alcoholic fatty liver disease
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection
hsa05142	Chagas disease
hsa05143	African trypanosomiasis
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 16313826
Cancer (endometrial)	GAD: 16515587
Cancer (esophageal)	GAD: 15240787
Cancer (head and neck)	GAD: 20819778
Cancer (Hepatocellular)	GAD: 17938571
Cancer (leukemia)	GAD: 20959405
Cancer (lung)	GAD: 14512182
Cancer (lymphoma)	GAD: 19669200
Cancer (melanoma)	GAD: 16538172
Cancer (myeloma)	GAD: 20568250
Cancer (nasopharyngeal)	GAD: 20842669
Cancer (ovarian)	GAD: 17465232
Adult T-cell leukemia	KEGG: H00009
Cancer (squamous cell)	OMIM: 134637
Cancer	GAD: 19168581
Cancer (Adenocarcinoma)	GAD: 20385987
Cancer (basal cell)	GAD: 20219325
Cancer (bladder)	GAD: 16538171
Cancer (cervical)	GAD: 15996722
Cancer (Renal cell)	GAD: 20572163
Cancer (Squamous cell)	GAD: 20359312
Cancer (stomach)	GAD: 17006606
Cancer (thyroid)	GAD: 17598974
Cancer (uterine cervical)	GAD: 19480241
Chronic lymphocytic leukemia	KEGG: H00005
Cancer (breast)	GAD: 17183065
Cardiovascular disease	GAD: 19262492
Heart disease	GAD: 20445134
Neuropathy	GAD: 15838728
Graves disease	GAD: 18972838
Eye diseases	GAD: 19293475
Sarcoidosis	GAD: 18588573
Thrombocytopenia	GAD: 16163374
Hodgkin disease	GAD: 19573080
Mycosis fungoides	KEGG: H01463
Sjogren's syndrome	GAD: 14672901
Multiple sclerosis	GAD: 15218339
Ulcerative colitis	GAD: 19653342
Scleroderma	GAD: 18445624
Systemic lupus erythematosus (SLE)	GAD: 18174230
Systemic lupus erythematosus (SLE)	GAD: 12064832
Autoimmune diseases	OMIM: 134637
Celiac disease	GAD: 14991945
Crohn's disease	GAD: 15637757
Obesity	GAD: 15220220
Diabetes	GAD: 16691186
Spondylarthropathies	GAD: 11771526
Bone diseases	GAD: 18090928
Juvenile idiopathic arthritis	GAD: 11824955
Alzheimer's disease	GAD: 16921240
Cirrhosis	GAD: 15929764
Chronic renal failure	GAD: 21085059
Azoospermia	GAD: 19146781
Preeclampsia	GAD: 15695771
Ectopic endometriosis	INFBASE: 9065182
Endometriosis	INFBASE: 15806311
Endometriosis	INFBASE: 16533339
Recurrent pregnancy loss (RPL)	INFBASE: 23218678
Abnormal seminal plasma	MIK: 23422491
Altered sperm apoptosis	MIK: 19542541
Altered sperm apoptosis	MIK: 19542541
Male factor infertility	MIK: 20549554
Poor semen quality	MIK: 19542541
Male factor infertility	MIK: 23422491
Infertility	MIK: 18439588
Gamete quality	MIK: 10946867
Semen analysis	MIK: 23422491
Male factor infertility	MIK: 10946867
Polycystic ovary syndrome (PCOS)	MIK: 10966981
Spermatogenesis defects	MIK: 11870228
Varicocele	MIK: 23910090
Varicocele	MIK: 14634417
Oligozoospermia	MIK: 19146781
Cryptorchidism	MIK: 12793288
HELLP syndrome	GAD: 16507928
Azoospermia	MIK: 24665877
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Systemic sclerosis	GAD: 19950259
Connective tissue diseases	GAD: 19527514
Abnormal seminal plasma	MIK: 23422491
Altered sperm apoptosis	MIK: 19542541
Poor semen quality	MIK: 19542541
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Cryptorchidism	MIK: 12793288
Gamete quality	MIK: 10946867
Azoospermia	MIK: 24665877
Oligozoospermia	MIK: 19146781
Oligoasthenozoospermia	MIK: 18439588
Low sperm motility	MIK: 21674046
Male infertility	MIK: 14555327
May reduce testicular damage induced by cryptorchidism	MIK: 19331798
Polycystic ovary syndrome (PCOS)	MIK: 10966981
Spermatogenesis defects	MIK: 11870228
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 23910090

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
14555327	Male infertility				Male infertility	Fas IL-6 IL-8
23422491	Male infertility			72 (24 were normal, 48 abnormal)	Male infertility	FAS FASL
19542541	Male infertility	FAS-670A/G (rs1800682: A>G), CASP8-652 6N ins/del (rs3834129: -/CTTACT)		620 infertile men	Male infertility	FAS FASLG and CASP8
23910090	Varicocele, Male infertility			230 men were prospectively investigated: fertile men without Vx, fertile men with Vx, infertile men without Vx, and infertile men with Vx.	Male infertility
24665877	Idiopathic azoospermia	FAS -670A/G, -1377G/A, and FASLG -124A/G	Southea st turk ey	233 (108 infertile men with idiopathic azoospermia, 125 proven fertile controls)	Male infertility	FAS FASLG
23422491	Semen analysis	CAG and GGN polymorphisms		72 (24 were normal, 48 abnormal)	Male infertility	FAS FASLG
20549554	Male factor infertility			83 (10 fertile, 73 infertile individuals with diagnoses of male factor infertility)	Male infertility
19542541	Altered sperm apoptosis, poor semen quality	FAS-670A/G (rs1800682: A>G) and CASP8-652 6N ins/del (rs3834129: -/CTTACT)		620 infertile men	Male infertility	FAS FASLG and CASP8
19146781	Idiopathic azoospermia or severe oligozoospermia	FAS -1377G/A and -670A/G SNP and FASLG -844C/T	Han Chi nese	449 (203 infertile men with idiopathic azoospermia or severe oligozoospermia, 246 proven fertile controls)	Male infertility	FAS FASLG
15019807	Male infertility			45 infertile men, 10 fertile men	Male infertility
14634417	Male infertility with varicocele			120 (27 oligozoospermic men with varicocele, 59 oligozoospermic men without varicocele and 34 normal volunteers)	Male infertility	Fas FasL
14555327	Male infertility				Male infertility	Fas IL-6 and IL-8
12793288	Cryptorchidism				Male infertility
11870228	Spermatogenesis			30 (10 normal spermatogenesis, 10 complete early maturation arrest (EMA), 10 incomplete late maturation arrest )	Male infertility
23422491	Abnormal seminal plasma			72 (24 were normal, 48 abnormal)	Male infertility	FAS FASLG
14634417	Male infertility, varicocele			120 (27 oligozoospermic men with varicocele, 59 oligozoospermic men without varicocele and 34 normal volunteers)	Male infertility	Fas FasL
10946867	Gamete quality			20 (10 biopsies with postmeiotic germ cell arrest, 10 normal testis biopsies)	Male infertility	Fas FasL
18439588	Infertile oligoasthenozoospermia with varicocele			88 (12 fertile healthy controls, 31 fertile normozoospermia with varicocele, 45 infertile oligoasthenozoospermia with varicocele)	Male infertility	Fas
10966981	PCOS
19331798	May reduce testicular damage induced by cryptorchidism				Male infertility
28942044	Idiopathic azoospermia, Male infertility	FAS-670A/G and FASL-844C/T polymorphisms		212 (102 infertile men, 110 normal fertile men as control group)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Low sperm motility			18	Male infertility	GSE26881