• Gene id: 3543

Gene Summary

• Gene Symbol: IGLL1   Gene   UCSC   Ensembl
• Aliases: 14.1, AGM2, CD179b, IGL1, IGL5, IGLJ14.1, IGLL, IGO, IGVPB, VPREB2
• Gene name: immunoglobulin lambda like polypeptide 1
• Alternate names: immunoglobulin lambda-like polypeptide 1, CD179 antigen-like family member B, CD179b antigen, Pre-B lymphocyte-specific protein-2, ig lambda-5, immunoglobulin omega polypeptide chain, immunoglobulin-related 14.1 protein, immunoglobulin-related protein 14.1, lambd,
• Gene location: 22q11.23 (23580289: 23573124)     Exons: 3     NC_000022.11
• Gene summary(Entrez): The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locu
• OMIM: 600786

Protein Summary

• Protein general information: P15814  
  • Name: Immunoglobulin lambda like polypeptide 1 (CD179 antigen like family member B) (Ig lambda 5) (Immunoglobulin omega polypeptide) (Immunoglobulin related protein 14.1) (CD antigen CD179b)
  • Length: 213  
  • Mass: 22963
  • Tissue specificity: Expressed only in pre-B-cells and a special B-cell line (which is surface Ig negative). {ECO
• Sequence:

  MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRG
  SWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWK
  ADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS

• Structural information:
  • Protein Domains: (114..20-)
    (/note="Ig-like-C1-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003006  IPR003597  
  • Prosite: PS50835 PS00290
  • PDB: 2H32 2H3N 2LKQ
  • PDBsum: 2H32 2H3N 2LKQ
  • STRING: ENSP00000329312
• Other Databases: GeneCards:  IGLL1  Malacards:  IGLL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003823	antigen binding	IBA	molecular function
GO:0006911	phagocytosis, engulfment	IBA	biological process
GO:0006958	complement activation, classical pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0034987	immunoglobulin receptor binding	IBA	molecular function
GO:0042571	immunoglobulin complex, circulating	IBA	cellular component
GO:0042742	defense response to bacterium	IBA	biological process
GO:0050871	positive regulation of B cell activation	IBA	biological process
GO:0006910	phagocytosis, recognition	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0050853	B cell receptor signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	NAS	cellular component
GO:0006955	immune response	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05340	Primary immunodeficiency

Diseases

Associated diseases	References
Agammaglobulinemias	KEGG:H00085
Agammaglobulinemias	KEGG:H00085
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881