• Gene id: 353514

Gene Summary

• Gene Symbol: LILRA5   Gene   UCSC   Ensembl
• Aliases: CD85, CD85F, ILT-11, ILT11, LILRB7, LIR-9, LIR9
• Gene name: leukocyte immunoglobulin like receptor A5
• Alternate names: leukocyte immunoglobulin-like receptor subfamily A member 5, CD85 antigen-like family member F, immunoglobulin-like transcript 11 protein, leucocyte Ig-like receptor A5, leukocyte Ig-like receptor 9, leukocyte immunoglobulin-like receptor 9, leukocyte immunoglo,
• Gene location: 19q13.42 (100266157: 100292768)     Exons: 12     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes
• OMIM: 606047

Protein Summary

• Protein general information: A6NI73  
  • Name: Leukocyte immunoglobulin like receptor subfamily A member 5 (CD85 antigen like family member F) (Immunoglobulin like transcript 11) (ILT 11) (Leukocyte immunoglobulin like receptor 9) (LIR 9) (CD antigen CD85f)
  • Length: 299  
  • Mass: 32755
  • Tissue specificity: Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not
• Sequence:

  MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQE
  YRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSP
  VVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVW
  SEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR

• Structural information:
  • Protein Domains: (51..13-)
    1 (/note="Ig-like-C2-type)
    (142..23-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
  • PDB: 2D3V
  • PDBsum: 2D3V
  • STRING: ENSP00000404236
• Other Databases: GeneCards:  LILRA5  Malacards:  LILRA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1904469	positive regulation of tumor necrosis factor secretion	IDA	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:0050867	positive regulation of cell activation	IDA	biological process
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:2001183	negative regulation of interleukin-12 secretion	IDA	biological process
GO:2001181	positive regulation of interleukin-10 secretion	IDA	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:2000666	negative regulation of interleukin-13 secretion	IDA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:1904469	positive regulation of tumor necrosis factor secretion	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IMP	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)