• Gene id: 353238

Gene Summary

• Gene Symbol: PADI6   Gene   UCSC   Ensembl
• Aliases: PREMBL2, hPADVI
• Gene name: peptidyl arginine deiminase 6
• Alternate names: protein-arginine deiminase type-6, peptidyl arginine deiminase, type VI, peptidyl arginine deiminase-like protein, peptidylarginine deiminase type 6,
• Gene location: 1p36.13 (17372195: 17401698)     Exons: 16     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distin
• OMIM: 611012

Protein Summary

• Protein general information: Q6TGC4  
  • Name: Protein arginine deiminase type 6 (EC 3.5.3.15) (Peptidyl arginine deiminase like protein) (Peptidylarginine deiminase VI) (hPADVI) (Protein arginine deiminase type VI)
  • Length: 694  
  • Mass: 77727
  • Tissue specificity: Highly expressed in oocytes and weakly expressed in other somatic tissues. {ECO
• Sequence:

  MVSVEGRAMSFQSIIHLSLDSPVHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLIDVANTVISEKEDATIWW
  PLSDPTYATVKMTSPSPSVDADKVSVTYYGPNEDAPVGTAVLYLTGIEVSLEVDIYRNGQVEMSSDKQAKKKWIW
  GPSGWGAILLVNCNPADVGQQLEDKKTKKVIFSEEITNLSQMTLNVQGPSCILKKYRLVLHTSKEESKKARVYWP
  QKDNSSTFELVLGPDQHAYTLALLGNHLKETFYVEAIAFPSAEFSGLISYSVSLVEESQDPSIPETVLYKDTVVF
  RVAPCVFIPCTQVPLEVYLCRELQLQGFVDTVTKLSEKSNSQVASVYEDPNRLGRWLQDEMAFCYTQAPHKTTSL
  ILDTPQAADLDEFPMKYSLSPGIGYMIQDTEDHKVASMDSIGNLMVSPPVKVQGKEYPLGRVLIGSSFYPSAEGR
  AMSKTLRDFLYAQQVQAPVELYSDWLMTGHVDEFMCFIPTDDKNEGKKGFLLLLASPSACYKLFREKQKEGYGDA
  LLFDELRADQLLSNGREAKTIDQLLADESLKKQNEYVEKCIHLNRDILKTELGLVEQDIIEIPQLFCLEKLTNIP
  SDQQPKRSFARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLEPLGFKCTFINDFDCYLTEVGDIC
  ACANIRRVPFAFKWWKMVP

• Structural information:
  • Interpro: IPR008972  IPR004303  IPR013530  IPR036556  IPR013732   IPR038685  IPR013733  
  • PDB: 4DAT 4DAU
  • PDBsum: 4DAT 4DAU
  • STRING: ENSP00000483125
• Other Databases: GeneCards:  PADI6  Malacards:  PADI6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036414	histone citrullination	IBA	biological process
GO:0004668	protein-arginine deiminase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0018101	protein citrullination	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0018101	protein citrullination	IEA	biological process
GO:0043143	regulation of translation by machinery localization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007028	cytoplasm organization	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0045111	intermediate filament cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Preimplantation embryonic lethality	KEGG:H02335
Preimplantation embryonic lethality	KEGG:H02335
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq