• Gene id: 353219

Gene Summary

• Gene Symbol: KAAG1   Gene   UCSC   Ensembl
• Aliases: RU2AS
• Gene name: kidney associated antigen 1
• Alternate names: kidney-associated antigen 1, RU2 antisense gene protein,
• Gene location: 6p22.3 (24356902: 24358284)     Exons: 1     NC_000006.12
• OMIM: 608211

Protein Summary

• Protein general information: Q9UBP8  
  • Name: Kidney associated antigen 1 (RU2 antisense gene protein)
  • Length: 84  
  • Mass: 8969
  • Tissue specificity: Expressed in testis and kidney, and, at lower levels, in urinary bladder and liver. Expressed by a high proportion of tumors of various histologic origin, including melanomas, sarcomas and colorectal carcinomas. {ECO
• Sequence:

  MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEK
  LTNPQVKEK

• Structural information:
  • Interpro: IPR029407  
  • STRING: ENSP00000274766
• Other Databases: GeneCards:  KAAG1  Malacards:  KAAG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006955	immune response	NAS	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)