• Gene id: 353189

Gene Summary

• Gene Symbol: SLCO4C1   Gene   UCSC   Ensembl
• Aliases: OATP-H, OATP-M1, OATP4C1, OATPX, PRO2176, SLC21A20
• Gene name: solute carrier organic anion transporter family member 4C1
• Alternate names: solute carrier organic anion transporter family member 4C1, organic anion transporter M1, solute carrier family 21 member 20,
• Gene location: 5q21.1 (102296515: 102233985)     Exons: 15     NC_000005.10
• Gene summary(Entrez): SLCO4C1 belongs to the organic anion transporter (OATP) family. OATPs are involved in the membrane transport of bile acids, conjugated steroids, thyroid hormone, eicosanoids, peptides, and numerous drugs in many tissues (Mikkaichi et al., 2004 [PubMed 149
• OMIM: 609013

Protein Summary

• Protein general information: Q6ZQN7  
  • Name: Solute carrier organic anion transporter family member 4C1 (OATP H) (Organic anion transporter M1) (OATP M1) (Solute carrier family 21 member 20)
  • Length: 724  
  • Mass: 78948
  • Tissue specificity: Predominantly expressed in kidney but also weakly expressed in both fetal liver and kidney. {ECO
• Sequence:

  MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKL
  RSLSLSEFEEGSYGWRNFHPQCLQRCNTPGGFLLHYCLLAVTQGIVVNGLVNISISTVEKRYEMKSSLTGLISSS
  YDISFCLLSLFVSFFGERGHKPRWLAFAAFMIGLGALVFSLPQFFSGEYKLGSLFEDTCVTTRNSTSCTSSTSSL
  SNYLYVFILGQLLLGAGGTPLYTLGTAFLDDSVPTHKSSLYIGTGYAMSILGPAIGYVLGGQLLTIYIDVAMGES
  TDVTEDDPRWLGAWWIGFLLSWIFAWSLIIPFSCFPKHLPGTAEIQAGKTSQAHQSNSNADVKFGKSIKDFPAAL
  KNLMKNAVFMCLVLSTSSEALITTGFATFLPKFIENQFGLTSSFAATLGGAVLIPGAALGQILGGFLVSKFRMTC
  KNTMKFALFTSGVALTLSFVFMYAKCENEPFAGVSESYNGTGELGNLIAPCNANCNCSRSYYYPVCGDGVQYFSP
  CFAGCSNPVAHRKPKVYYNCSCIERKTEITSTAETFGFEAKAGKCETHCAKLPIFLCIFFIVIIFTFMAGTPITV
  SILRCVNHRQRSLALGIQFMVLRLLGTIPGPIIFGFTIDSTCILWDINDCGIKGACWIYDNIKMAHMLVAISVTC
  KVITMFFNGFAIFLYKPPPSATDVSFHKENAVVTNVLAEQDLNKIVKEG

• Structural information:
  • Protein Domains: (495..54-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798"-)
  • Interpro: IPR002350  IPR036058  IPR020846  IPR036259  IPR004156  
  • Prosite: PS51465 PS50850
  • STRING: ENSP00000309741
• Other Databases: GeneCards:  SLCO4C1  Malacards:  SLCO4C1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015347	sodium-independent organic anion transmembrane transporter activity	IBA	molecular function
GO:0043252	sodium-independent organic anion transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043252	sodium-independent organic anion transport	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0015347	sodium-independent organic anion transmembrane transporter activity	TAS	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)