• Gene id: 353174

Gene Summary

• Gene Symbol: ZACN   Gene   UCSC   Ensembl
• Aliases: L2, LGICZ, LGICZ1, ZAC, ZAC1
• Gene name: zinc activated ion channel
• Alternate names: zinc-activated ligand-gated ion channel, ligand-gated ion channel subunit, ligand-gated ion channel zinc-activated 1, ligand-gated ion-channel receptor L2, zinc activated ligand-gated ion channel 1,
• Gene location: 17q25.1 (76079181: 76082805)     Exons: 9     NC_000017.11
• Gene summary(Entrez): LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 [PubMed 12381728]).[supplied by OMIM, Mar 2008]
• OMIM: 302650

Protein Summary

• Protein general information: Q401N2  
  • Name: Zinc activated ligand gated ion channel (Ligand gated ion channel zinc activated 1) (Ligand gated ion channel receptor L2)
  • Length: 412  
  • Mass: 45816
  • Tissue specificity: Detected in pancreas, brain, liver, placenta, trachea, kidney, spinal cord, stomach and fetal brain. In the adult brain region expression is detected in the hippocampus, striatum, amygdala and thalamus. {ECO
• Sequence:

  MMALWSLLHLTFLGFSITLLLVHGQGFQGTAAIWPSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVD
  ILRYTMSSMLLLRLSWLDTRLAWNTSAHPRHAITLPWESLWTPRLTILEALWVDWRDQSPQARVDQDGHVKLNLA
  LATETNCNFELLHFPRDHSNCSLSFYALSNTAMELEFQAHVVNEIVSVKREYVVYDLKTQVPPQQLVPCFQVTLR
  LKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIGYKVTLLLSYLVLHSSLVQALPSSSSCNPLLIYYFTIL
  LLLLFLSTIETVLLAGLLARGNLGAKSGPSPAPRGEQREHGNPGPHPAEEPSRGVKGSQRSWPETADRIFFLVYV
  VGVLCTQFVFAGIWMWAACKSDAAPGEAAPHGRRPRL

• Structural information:
  • Interpro: IPR006202  IPR036734  IPR006201  IPR036719  IPR018000  
  • Prosite: PS00236
  • STRING: ENSP00000334854
• Other Databases: GeneCards:  ZACN  Malacards:  ZACN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010043	response to zinc ion	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0050877	nervous system process	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005230	extracellular ligand-gated ion channel activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015276	ligand-gated ion channel activity	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0034220	ion transmembrane transport	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq