• Gene id: 352954

Gene Summary

• Gene Symbol: CASTOR3   Gene   UCSC   Ensembl
• Aliases: GATS, STAG3OS
• Gene name: CASTOR family member 3
• Alternate names: putative protein CASTOR 3, GATS, stromal antigen 3 opposite strand, STAG3 opposite strand transcript protein, opposite strand transcription unit to STAG3, putative protein GATS, stromal antigen 3 opposite strand,
• Gene location: 7q22.1 (100272273: 100187987)     Exons: 8     NC_000007.14

SNPs

rs10841496

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.20368720C>A
NC_000012.11   g.20521654C>A
NG_030033.1   g.4476C>A
NM_000921.5   c.-565C>A
NM_001378408.1   c.-1593C>A
NM_001378407.1   c.-565C>A|SEQ=[C/A]|GENE=PDE3A

rs1727130

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.100213841C>A
NC_000007.14   g.100213841C>G
NC_000007.14   g.100213841C>T
NC_000007.13   g.99811464C>A
NC_000007.13   g.99811464C>G
NC_000007.13   g.99811464C>T
NG_034114.1   g.41118C>A
NG_034114.1   g.41118C>G
NG_034114.1   g.41118C>T|SEQ=[C/A/G/T]|GE

Protein Summary

• Protein general information: Q8NAP1  
  • Name: Putative protein CASTOR 3 (STAG3 opposite strand transcript protein)
  • Length: 163  
  • Mass: 17846
• Sequence:

  MSCRGRGAGGRWNSTSWSTGCKLPASPRRVSRCSPTGLIKLAFLFSKTRCKFFSLTETPEDYTIIVDEEGFLELP
  SSEHLSVADATWLALNVVSGGGSFSSSQPIGMTKIAKSVIAPLADQNISVFMLSTYQTDFILVLKRDLPFVTHTL
  SSEFTILWSVARL

• Structural information:
  • Interpro: IPR040778  IPR027795  IPR026249  
  • STRING: ENSP00000389760
• Other Databases: GeneCards:  CASTOR3  Malacards:  CASTOR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903577	cellular response to L-arginine	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:1904262	negative regulation of TORC1 signaling	IBA	biological process
GO:1902531	regulation of intracellular signal transduction	IBA	biological process
GO:0061700	GATOR2 complex	IBA	colocalizes with

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)