• Gene id: 349667

Gene Summary

• Gene Symbol: RTN4RL2   Gene   UCSC   Ensembl
• Aliases: NGRH1, NgR2
• Gene name: reticulon 4 receptor like 2
• Alternate names: reticulon-4 receptor-like 2, Nogo-66 receptor homolog 1, nogo receptor-like 3, nogo-66 receptor-related protein 2,
• Gene location: 11q12.1 (57460527: 57477533)     Exons: 3     NC_000011.10

Protein Summary

• Protein general information: Q86UN3  
  • Name: Reticulon 4 receptor like 2 (Nogo receptor like 3) (Nogo 66 receptor homolog 1) (Nogo 66 receptor related protein 2) (NgR2)
  • Length: 420  
  • Mass: 46106
  • Tissue specificity: Highly expressed in brain and liver. Expressed at lower levels in kidney, mammary gland, placenta, skeletal muscle, spleen and thyroid. {ECO
• Sequence:

  MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTL
  RPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNI
  FRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRG
  LSRLTILYLFNNSLASLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLR
  ALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYG
  GEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL

• Structural information:
  • Protein Domains: (47..6-)
    (/note="LRRNT-)
    (261..31-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • STRING: ENSP00000335397
• Other Databases: GeneCards:  RTN4RL2  Malacards:  RTN4RL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0045121	membrane raft	ISS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0043204	perikaryon	ISS	cellular component
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0007166	cell surface receptor signaling pathway	ISS	biological process
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030424	axon	IEA	cellular component
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0022038	corpus callosum development	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0038023	signaling receptor activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031103	axon regeneration	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq