• Gene id: 3490

Gene Summary

• Gene Symbol: IGFBP7   Gene   UCSC   Ensembl
• Aliases: AGM, FSTL2, IBP-7, IGFBP-7, IGFBP-7v, IGFBPRP1, MAC25, PSF, RAMSVPS, TAF
• Gene name: insulin like growth factor binding protein 7
• Alternate names: insulin-like growth factor-binding protein 7, IGF-binding protein 7, IGFBP-rP1, PGI2-stimulating factor, angiomodulin, prostacyclin-stimulating factor, tumor-derived adhesion factor,
• Gene location: 4q12 (57110384: 57030772)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds
• OMIM: 602867

Protein Summary

• Protein general information: Q16270  
  • Name: Insulin like growth factor binding protein 7 (IBP 7) (IGF binding protein 7) (IGFBP 7) (IGFBP rP1) (MAC25 protein) (PGI2 stimulating factor) (Prostacyclin stimulating factor) (Tumor derived adhesion factor) (TAF)
  • Length: 282  
  • Mass: 29130
• Sequence:

  MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGG
  AGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQ
  VSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPE
  KHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

• Structural information:
  • Protein Domains: (28..10-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (105..15-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (160..26-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR009030  IPR007110  IPR036179  IPR013783  IPR013098   IPR003599  IPR000867  IPR011390  IPR002350  IPR036058  
  • Prosite: PS50835 PS51323 PS51465
  • STRING: ENSP00000295666
• Other Databases: GeneCards:  IGFBP7  Malacards:  IGFBP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001558	regulation of cell growth	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0007566	embryo implantation	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0051414	response to cortisol	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0050810	regulation of steroid biosynthetic process	IEA	biological process
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881