• Gene id: 3489

Gene Summary

• Gene Symbol: IGFBP6   Gene   UCSC   Ensembl
• Aliases: IBP6
• Gene name: insulin like growth factor binding protein 6
• Alternate names: insulin-like growth factor-binding protein 6, IBP-6, IGF binding protein 6, IGFBP-6,
• Gene location: 12q13.13 (53097666: 53102339)     Exons: 4     NC_000012.12

Protein Summary

• Protein general information: P24592  
  • Name: Insulin like growth factor binding protein 6 (IBP 6) (IGF binding protein 6) (IGFBP 6)
  • Length: 240  
  • Mass: 25322
• Sequence:

  MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYT
  PNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQP
  NSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGS
  PDGNGSSSCPTGSSG

• Structural information:
  • Protein Domains: (28..10-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (160..23-)
    (/note="Thyroglobulin-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00500"-)
  • Interpro: IPR009030  IPR022326  IPR000867  IPR009168  IPR022321   IPR000716  IPR036857  
  • Prosite: PS51323 PS00484 PS51162
  • CDD: cd00191
  • PDB: 1RMJ
  • PDBsum: 1RMJ
  • STRING: ENSP00000301464
• Other Databases: GeneCards:  IGFBP6  Malacards:  IGFBP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0043567	regulation of insulin-like growth factor receptor signaling pathway	IBA	biological process
GO:0031995	insulin-like growth factor II binding	IBA	molecular function
GO:0031994	insulin-like growth factor I binding	IBA	molecular function
GO:0001968	fibronectin binding	IBA	molecular function
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031995	insulin-like growth factor II binding	IEA	molecular function
GO:0031994	insulin-like growth factor I binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0042568	insulin-like growth factor binary complex	IMP	cellular component
GO:0031995	insulin-like growth factor II binding	IMP	molecular function

Diseases

Associated diseases	References
leiomyoma	PMID:15705628
Breast cancer	PMID:10069662
in situ carcinoma	PMID:15123780
Neovascular inflammatory vitreoretinopathy	PMID:23808406
obesity	PMID:15889232
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq