Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 3488
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol IGFBP5   Gene   UCSC   Ensembl
Aliases IBP5
Gene name insulin like growth factor binding protein 5
Alternate names insulin-like growth factor-binding protein 5, IBP-5, IGF-binding protein 5, IGFBP-5,
Gene location 2q35 (216695548: 216672104)     Exons: 4     NC_000002.12
OMIM 185261

Protein Summary
Protein general information P24593  

Name: Insulin like growth factor binding protein 5 (IBP 5) (IGF binding protein 5) (IGFBP 5)

Length: 272  Mass: 30570

Tissue specificity: Osteosarcoma, and at lower levels in liver, kidney and brain.

Sequence MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVYTERCA
QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAE
AVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFY
KRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Structural information
Protein Domains
 (23..10-)
(/note="IGFBP-N-terminal)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
(189..26-)
(/note="Thyroglobulin-type-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00500"-)
Interpro:  IPR009030  IPR012213  IPR000867  IPR009168  IPR022321  
IPR017891  IPR000716  IPR036857  
Prosite:   PS00222 PS51323 PS00484 PS51162
CDD:   cd00191

PDB:  		 1BOE 1H59
PDBsum:   1BOE 1H59

DIP:  
48433
STRING:   ENSP00000233813
Other Databases GeneCards:  IGFBP5  Malacards:  IGFBP5

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005615 extracellular space
 IBA cellular component
GO:0001968 fibronectin binding
 IBA molecular function
GO:0031994 insulin-like growth facto
r I binding
 IBA molecular function
GO:0031995 insulin-like growth facto
r II binding
 IBA molecular function
GO:0043567 regulation of insulin-lik
e growth factor receptor
signaling pathway
 IBA biological process
GO:0005576 extracellular region
 IEA cellular component
GO:0005520 insulin-like growth facto
r binding
 IEA molecular function
GO:0005576 extracellular region
 IEA cellular component
GO:0019838 growth factor binding
 IEA molecular function
GO:0007165 signal transduction
 NAS biological process
GO:0060416 response to growth hormon
e
 ISS biological process
GO:0044267 cellular protein metaboli
c process
 TAS biological process
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005788 endoplasmic reticulum lum
en
 TAS cellular component
GO:0043687 post-translational protei
n modification
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0007568 aging
 IEA biological process
GO:1901862 negative regulation of mu
scle tissue development
 IEA biological process
GO:0060056 mammary gland involution
 IEA biological process
GO:0051146 striated muscle cell diff
erentiation
 IEA biological process
GO:0043569 negative regulation of in
sulin-like growth factor
receptor signaling pathwa
y
 IEA biological process
GO:0042593 glucose homeostasis
 IEA biological process
GO:0031069 hair follicle morphogenes
is
 IEA biological process
GO:0007565 female pregnancy
 IEA biological process
GO:0001649 osteoblast differentiatio
n
 IEA biological process
GO:0001558 regulation of cell growth
 IEA biological process
GO:0035556 intracellular signal tran
sduction
 IEA biological process
GO:0005520 insulin-like growth facto
r binding
 IEA molecular function
GO:1904205 negative regulation of sk
eletal muscle hypertrophy
 IEA biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
 IEA biological process
GO:0048286 lung alveolus development
 IEA biological process
GO:0045926 negative regulation of gr
owth
 IEA biological process
GO:0045668 negative regulation of os
teoblast differentiation
 IEA biological process
GO:0044342 type B pancreatic cell pr
oliferation
 IEA biological process
GO:0043568 positive regulation of in
sulin-like growth factor
receptor signaling pathwa
y
 IEA biological process
GO:0040008 regulation of growth
 IEA biological process
GO:0001968 fibronectin binding
 IEA molecular function
GO:1904707 positive regulation of va
scular smooth muscle cell
proliferation
 IGI biological process
GO:1904754 positive regulation of va
scular associated smooth
muscle cell migration
 IGI biological process
GO:0042567 insulin-like growth facto
r ternary complex
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0031994 insulin-like growth facto
r I binding
 IPI molecular function
GO:0014912 negative regulation of sm
ooth muscle cell migratio
n
 IDA biological process
GO:0017148 negative regulation of tr
anslation
 IDA biological process
GO:0030336 negative regulation of ce
ll migration
 IDA biological process
GO:0043569 negative regulation of in
sulin-like growth factor
receptor signaling pathwa
y
 IDA biological process
GO:0016942 insulin-like growth facto
r binding protein complex
 IC cellular component
GO:0048662 negative regulation of sm
ooth muscle cell prolifer
ation
 IDA biological process
GO:0005576 extracellular region
 IEA cellular component
GO:0071320 cellular response to cAMP
 IDA biological process
GO:0071407 cellular response to orga
nic cyclic compound
 IDA biological process
GO:0005576 extracellular region
 NAS cellular component

Diseases

Expand All | Collapse All
Associated diseases References
Pulmonary fibrosis PMID:15681824
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract