• Gene id: 3485

Gene Summary

• Gene Symbol: IGFBP2   Gene   UCSC   Ensembl
• Aliases: IBP2, IGF-BP53
• Gene name: insulin like growth factor binding protein 2
• Alternate names: insulin-like growth factor-binding protein 2, IGF-binding protein 2, insulin-like growth factor binding protein 2, 36kDa,
• Gene location: 2q35 (216632827: 216664435)     Exons: 6     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can rema
• OMIM: 123980

Protein Summary

• Protein general information: P18065  
  • Name: Insulin like growth factor binding protein 2 (IBP 2) (IGF binding protein 2) (IGFBP 2)
  • Length: 325  
  • Mass: 34814
• Sequence:

  MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPC
  AELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNG
  DDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPART
  PCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
  RGDPECHLFYNEQQEARGVHTQRMQ

• Structural information:
  • Protein Domains: (38..13-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (224..30-)
    (/note="Thyroglobulin-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00500"-)
  • Interpro: IPR009030  IPR012210  IPR000867  IPR009168  IPR022321   IPR017891  IPR000716  IPR036857  
  • Prosite: PS00222 PS51323 PS00484 PS51162
  • CDD: cd00191
  • PDB: 2H7T
  • PDBsum: 2H7T
  • STRING: ENSP00000233809
• Other Databases: GeneCards:  IGFBP2  Malacards:  IGFBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0043567	regulation of insulin-like growth factor receptor signaling pathway	IBA	biological process
GO:0031995	insulin-like growth factor II binding	IBA	molecular function
GO:0031994	insulin-like growth factor I binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0040008	regulation of growth	IEA	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0010226	response to lithium ion	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0048545	response to steroid hormone	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0031994	insulin-like growth factor I binding	IEA	molecular function
GO:0031995	insulin-like growth factor II binding	IEA	molecular function
GO:0032526	response to retinoic acid	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0043567	regulation of insulin-like growth factor receptor signaling pathway	IC	biological process
GO:0031994	insulin-like growth factor I binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	ISS	cellular component
GO:0031995	insulin-like growth factor II binding	ISS	molecular function
GO:0043567	regulation of insulin-like growth factor receptor signaling pathway	ISS	biological process

Diseases

Associated diseases	References
Alzheimer's disease	PMID:18479783
Kuhnt-Junius degeneration	PMID:24106111
obesity	PMID:17426323
obesity	PMID:17259371
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq