• Gene id: 3484

Gene Summary

• Gene Symbol: IGFBP1   Gene   UCSC   Ensembl
• Aliases: AFBP, IBP1, IGF-BP25, PP12, hIGFBP-1
• Gene name: insulin like growth factor binding protein 1
• Alternate names: insulin-like growth factor-binding protein 1, IBP-1, IGF-binding protein 1, IGFBP-1, alpha-pregnancy-associated endometrial globulin, amniotic fluid binding protein, binding protein-25, binding protein-26, binding protein-28, growth hormone independent-binding pro,
• Gene location: 7p12.3 (45888487: 45893659)     Exons: 4     NC_000007.14
• Gene summary(Entrez): This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma an
• OMIM: 146730

Protein Summary

• Protein general information: P08833  
  • Name: Insulin like growth factor binding protein 1 (IBP 1) (IGF binding protein 1) (IGFBP 1) (Placental protein 12) (PP12)
  • Length: 259  
  • Mass: 27904
• Sequence:

  MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVAT
  ARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSI
  LWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEA
  GLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

• Structural information:
  • Protein Domains: (26..10-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (173..25-)
    (/note="Thyroglobulin-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00500"-)
  • Interpro: IPR009030  IPR000867  IPR022322  IPR009168  IPR022321   IPR017891  IPR000716  IPR036857  
  • Prosite: PS00222 PS51323 PS00484 PS51162
  • CDD: cd00191
  • PDB: 1ZT3 1ZT5 2DSQ
  • PDBsum: 1ZT3 1ZT5 2DSQ
  • DIP: 59846
  • STRING: ENSP00000275525
• Other Databases: GeneCards:  IGFBP1  Malacards:  IGFBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0043567	regulation of insulin-like growth factor receptor signaling pathway	IBA	biological process
GO:0031995	insulin-like growth factor II binding	IBA	molecular function
GO:0031994	insulin-like growth factor I binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0005520	insulin-like growth factor binding	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0042246	tissue regeneration	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0031994	insulin-like growth factor I binding	IDA	molecular function
GO:0031995	insulin-like growth factor II binding	IDA	molecular function

Diseases

Associated diseases	References
Diabetic angiopathy	PMID:16306374
Breast cancer	PMID:10069662
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881