• Gene id: 3483

Gene Summary

• Gene Symbol: IGFALS   Gene   UCSC   Ensembl
• Aliases: ACLSD, ALS
• Gene name: insulin like growth factor binding protein acid labile subunit
• Alternate names: insulin-like growth factor-binding protein complex acid labile subunit, insulin-like growth factor binding protein complex acid labile chain,
• Gene location: 16p13.3 (1794907: 1790412)     Exons: 3     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth
• OMIM: 601489

Protein Summary

• Protein general information: P35858  
  • Name: Insulin like growth factor binding protein complex acid labile subunit (ALS)
  • Length: 605  
  • Mass: 66,035
• Sequence:

  MALRKGGLALALLLLSWVALGPRSLEGADPGTPGEAEGPACPAACVCSYDDDADELSVFCSSRNLTRLPDGVPGG
  TQALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALGTFAHTPALAS
  LGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDL
  SRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHN
  AIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLR
  NLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLP
  HRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVSHNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQP
  PGLERLWLEGNPWDCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEA
  HFAPC

• Structural information:
  • Protein Domains: LRRNT (32-74)
    LRRCT. (536-605)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • STRING: ENSP00000416683
• Other Databases: GeneCards:  IGFALS  Malacards:  IGFALS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005520	insulin-like growth factor binding	TAS	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0042567	insulin-like growth factor ternary complex	IDA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005520	insulin-like growth factor binding	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0042567	insulin-like growth factor ternary complex	IDA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005520	insulin-like growth factor binding	TAS	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0042567	insulin-like growth factor ternary complex	IDA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Cancer	GAD: 16404426
Cancer (prostate)	GAD: 19455605
Cancer (lung)	GAD: 18676680
Cancer (breast)	GAD: 16404426
Obesity	GAD: 20734064
Bone diseases	GAD: 19453261
Delayed puberty	MIK: 23488611
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Growth disorders	GAD: 20591980
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Delayed puberty	MIK: 23488611
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23488611	Delayed puberty	IGFALS, c.380T>C (p.L127P)		2 siblings with delayed puberty	Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray