• Gene id: 348262

Gene Summary

• Gene Symbol: MCRIP1   Gene   UCSC   Ensembl
• Aliases: FAM195B, GRAN2, MCRIP
• Gene name: MAPK regulated corepressor interacting protein 1
• Alternate names: mapk-regulated corepressor-interacting protein 1, MAPK-regulated co-repressor interacting protein 1, MCRIP1 protein, family with sequence similarity 195, member B, granulin-2, protein FAM195B,
• Gene location: 17q25.3 (81833290: 81822360)     Exons: 7     NC_000017.11
• OMIM: 616514

Protein Summary

• Protein general information: C9JLW8  
  • Name: Mapk regulated corepressor interacting protein 1 (Granulin 2) (Protein FAM195B)
  • Length: 97  
  • Mass: 10920
• Sequence:

  MTSSPVSRVVYNGKRTSSPRSPPSSSEIFTPAHEENVRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSL
  KTFKPIDLSDLKRRSTQDAKKS

• Structural information:
  • Interpro: IPR029428  
  • STRING: ENSP00000461433
• Other Databases: GeneCards:  MCRIP1  Malacards:  MCRIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0010717	regulation of epithelial to mesenchymal transition	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq